LOCUS       NM_001424689            3143 bp    mRNA    linear   ROD 13-MAY-2024
DEFINITION  Mus musculus Pbx/knotted 1 homeobox 2 (Pknox2), transcript variant
            7, mRNA.
ACCESSION   NM_001424689 XM_011242440
VERSION     NM_001424689.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 3143)
  AUTHORS   Chen,L., Li,H., Liu,X., Zhang,N., Wang,K., Shi,A., Gao,H.,
            Akdis,D., Saguner,A.M., Xu,X., Osto,E., Van de Veen,W., Li,G.,
            Bayes-Genis,A., Duru,F., Song,J., Li,X. and Hu,S.
  TITLE     PBX/Knotted 1 homeobox-2 (PKNOX2) is a novel regulator of
            myocardial fibrosis
  JOURNAL   Signal Transduct Target Ther 9 (1), 94 (2024)
   PUBMED   38644381
  REMARK    GeneRIF: PBX/Knotted 1 homeobox-2 (PKNOX2) is a novel regulator of
            myocardial fibrosis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3143)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   3  (bases 1 to 3143)
  AUTHORS   Trigila,A.P., Castagna,V.C., Berasain,L., Montini,D.,
            Rubinstein,M., Gomez-Casati,M.E. and Franchini,L.F.
  TITLE     Accelerated Evolution Analysis Uncovers PKNOX2 as a Key
            Transcription Factor in the Mammalian Cochlea
  JOURNAL   Mol Biol Evol 40 (7) (2023)
   PUBMED   37247388
  REMARK    GeneRIF: Accelerated Evolution Analysis Uncovers PKNOX2 as a Key
            Transcription Factor in the Mammalian Cochlea.
REFERENCE   4  (bases 1 to 3143)
  AUTHORS   Miyake,Y., Obana,M., Nakae,T., Yamamoto,A., Tanaka,S., Maeda,M.,
            Okada,Y. and Fujio,Y.
  TITLE     PKNOX2 regulates myofibroblast functions and tubular cell survival
            during kidney fibrosis
  JOURNAL   Biochem Biophys Res Commun 571, 88-95 (2021)
   PUBMED   34311199
  REMARK    GeneRIF: PKNOX2 regulates myofibroblast functions and tubular cell
            survival during kidney fibrosis.
REFERENCE   5  (bases 1 to 3143)
  AUTHORS   Lopez-Gonzalez,L., Alonso,A., Garcia-Calero,E., de Puelles,E. and
            Puelles,L.
  TITLE     Tangential Intrahypothalamic Migration of the Mouse Ventral
            Premamillary Nucleus and Fgf8 Signaling
  JOURNAL   Front Cell Dev Biol 9, 676121 (2021)
   PUBMED   34095148
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3143)
  AUTHORS   Zhang,X., Rowan,S., Yue,Y., Heaney,S., Pan,Y., Brendolan,A.,
            Selleri,L. and Maas,R.L.
  TITLE     Pax6 is regulated by Meis and Pbx homeoproteins during pancreatic
            development
  JOURNAL   Dev Biol 300 (2), 748-757 (2006)
   PUBMED   17049510
REFERENCE   7  (bases 1 to 3143)
  AUTHORS   Ferretti,E., Villaescusa,J.C., Di Rosa,P., Fernandez-Diaz,L.C.,
            Longobardi,E., Mazzieri,R., Miccio,A., Micali,N., Selleri,L.,
            Ferrari,G. and Blasi,F.
  TITLE     Hypomorphic mutation of the TALE gene Prep1 (pKnox1) causes a major
            reduction of Pbx and Meis proteins and a pleiotropic embryonic
            phenotype
  JOURNAL   Mol Cell Biol 26 (15), 5650-5662 (2006)
   PUBMED   16847320
REFERENCE   8  (bases 1 to 3143)
  AUTHORS   Mulligan,M.K., Ponomarev,I., Hitzemann,R.J., Belknap,J.K.,
            Tabakoff,B., Harris,R.A., Crabbe,J.C., Blednov,Y.A., Grahame,N.J.,
            Phillips,T.J., Finn,D.A., Hoffman,P.L., Iyer,V.R., Koob,G.F. and
            Bergeson,S.E.
  TITLE     Toward understanding the genetics of alcohol drinking through
            transcriptome meta-analysis
  JOURNAL   Proc Natl Acad Sci U S A 103 (16), 6368-6373 (2006)
   PUBMED   16618939
REFERENCE   9  (bases 1 to 3143)
  AUTHORS   Haller,K., Rambaldi,I., Daniels,E. and Featherstone,M.
  TITLE     Subcellular localization of multiple PREP2 isoforms is regulated by
            actin, tubulin, and nuclear export
  JOURNAL   J Biol Chem 279 (47), 49384-49394 (2004)
   PUBMED   15339927
  REMARK    GeneRIF: transcriptional regulation by PREP2 is modulated through
            the subcellular distribution of multiple isoforms and by
            interaction with two distinct cytoskeletal systems
REFERENCE   10 (bases 1 to 3143)
  AUTHORS   Haller,K., Rambaldi,I., Kovacs,E.N., Daniels,E. and Featherstone,M.
  TITLE     Prep2: cloning and expression of a new prep family member
  JOURNAL   Dev Dyn 225 (3), 358-364 (2002)
   PUBMED   12412021
  REMARK    GeneRIF: Prep2 functions to varying degrees in a broad array of
            tissues and developmental processes.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC164087.5 and CT009699.13.
            
            On Oct 4, 2023 this sequence version replaced XM_011242440.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR7345562.2138183.1,
                                           SRR12282455.24546372.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164139
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-26                AC164087.5         198302-198327       c
            27-96               AC164087.5         134268-134337       c
            97-201              CT009699.13        158945-159049       c
            202-310             CT009699.13        140155-140263       c
            311-450             CT009699.13        126470-126609       c
            451-622             CT009699.13        108098-108269       c
            623-811             CT009699.13        95361-95549         c
            812-888             CT009699.13        67088-67164         c
            889-1067            CT009699.13        66097-66275         c
            1068-3143           CT009699.13        62759-64834         c
FEATURES             Location/Qualifiers
     source          1..3143
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 20.7 cM"
     gene            1..3143
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="Pbx/knotted 1 homeobox 2"
                     /db_xref="GeneID:208076"
                     /db_xref="MGI:MGI:2445415"
     misc_feature    212..214
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="upstream in-frame stop codon"
     CDS             224..1300
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="isoform 3 is encoded by transcript variant 7;
                     homeobox protein PKNOX2; PBX/knotted homeobox 2; homeobox
                     protein PREP-2; homeodomain containing transcription
                     factor PREP2"
                     /codon_start=1
                     /product="homeobox protein PKNOX2 isoform 3"
                     /protein_id="NP_001411618.1"
                     /db_xref="GeneID:208076"
                     /db_xref="MGI:MGI:2445415"
                     /translation="

MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSATASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGTPGTNPDGSINLDNLQSLSSDNATMAMQQAMMAAHDDSLDGTEEEDEDDMEEEEEEEEELEEEADELQTTNVSDLGLEHSDSLE"

     misc_feature    224..349
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8BG99.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     regulatory      3120..3125
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="hexamer: AGTAAA"
     polyA_site      3143
                     /gene="Pknox2"
                     /gene_synonym="D230005H23Rik; Prep2"
                     /note="major polyA site"
ORIGIN      

gtcagtctgatgaagattggcatcaggtgaacctagaagaagactttaaggggttctggttttccatgctgctcactagaaaagaagccctgaactgtactctctctatagctgactagaggtgtttctggcccagctggaagtgagaagagggggcagaccccctgaagaccatcccagaggcagtgggatcctccaacaatcctccatgtgaatcaatcccatgatgcaacatgcctccccagccccagctctgacaatgatggccacgcagaatgtccctcccccaccctaccaggacagcccccagatgacagcaactgcccagccaccttccaaggcccaggctgtccacatctcagcaccctcagctaccgccagcacacctgtgcccagtgcccccattgatccccaagcccagctggaggctgacaagcgagctgtgtacaggcaccctcttttcccgctcctgacgctgctgtttgagaaatgtgaacaggccacccagggctccgagtgcatcacctccgccagctttgatgtggacatcgagaactttgtccaccagcaggagcaggaacacaaacccttcttcagcgatgacccagaactggacaatctgatggtgaaggcaatccaggtcctgaggatccacctgctagagttggagaaagtcaatgagctctgcaaggacttttgcaaccgttacatcacctgcctcaaaaccaagatgcacagtgataacctgctcaggaatgacctcggggggccctactcccccaaccagccctccataaaccttcactcacagcacccctatcccactgaagatgagaagaggcagattgccgcgcagacaaacctcacccttctgcaagtaaacaactggttcatcaatgccaggaggcgcatcctgcagcccatgcttgatgccagcaacccagatcctgctcccaaagccaagaaaatcaagtctcagcaccggcccacccaaagattctggcccaattccattgctgctggggttctgcaacagcagggtggcaccccagggacgaaccctgatggttccatcaacttggacaacctgcagtccctgtcctcagacaatgccaccatggccatgcagcaggcaatgatggctgcacatgatgattcattggatggcacggaagaagaggatgaagatgatatggaggaggaggaagaggaggaggaggagctagaggaggaggctgatgagctacagacaacgaatgtcagcgacctgggcttggaacacagtgactccctggagtagtcaggcagcccagattgcgctggtcaccgagcaggaaaggagtgtcatcaggagggttcagggtggggggaggagatatgggcaggcagcactaagaaagttgggccctagcttccccgaatcatagcttgaagaaatgcagaggagacaccctgctcctttccaaccaccaagcttcagtgaaaacctagtcccagaccctcagactacagagcactccattgctggggccagccaaacagcctgagaagaaagacagcgtgagatctggactcaccgaataccagagatgacacccatggctccgcatggaaaaagacttgatttgtttacaagccactgccctgtgaggtggacaggcgctgcttgcagagcgaacctttgctaaggggcagacttgggagggaaggatgagaaagaaggggtctaacattttcccccaggagaatctgagctcccttgaaagacactcacggacagaaaggagcccaaatgcataaccagtggccagaggagtgggagggcctgagacaacaccacacccttcatatcagagtggaacgtggactgcacagggctccaacttaccctaccaggaccctgtctcttggcacagcagccatggactataaggagagggggaaggaaaccaaagagactccttcttcctctcttggaaatacattgtaggtgggtccaacctgaagaggttaagagcaactctacatctgggtcagctcgaggaccaagcaggtagcagaacctggatcaggagccatattaagatgactttggggatcccagcagtccctacgtgatcacatagctcctgtcacaataggaccatagtgtcttattagatgttcctaccctcagatggagttcttcagagaccccagccccctccataaacctttaggggttctttccactccacaggtcttcgtggtatccctctgctcccaagctggcactaccagcttctggcctcctccttcattctattctccagagaaggcagaagaaacattggaaagaagcattgtcccaatgggaagccagggtctgaagaaggtgctactgctcttaccttcaggactcaacatggcaggggatatagcgcccagctgatccacacacaccatgcttggcatctgctcctcctgtcccctcccaccctgtggctgtgaaagacaggactgaccacacgtgtgttttccgttgggtttaatgtgatgggtgtgcagttccttcatttgtaagtgtgcattggccatctccttcagtgctaggatgtgaatggctatctggctcaaccagagggcactcttgcgaccttctgagccttctcctcctctacctggttgggtggagcaaaaggatagtcacttttctgaggtctcccggaaatgaatgtatttctcccccaaaagagctgatatttaatgttttactagggatttttgagaaacaaataaccttatttataatctgggcgatccaatcatttttttactcccttttgatgccatacctagaggaaaggcaagctttttggcgtgagacttttgcaacccacaatgggataaaacatttcctcttctggttcatttttcttgttaaagtacatacatccacacataaattcctccactcagcaccgtgacaagctcccttcttcagcacggacatgtgtgcatacgtgcacatggatacacatgtctacatctccctcctagccccttccacctgcctaatgttacgcaacctccttctgatgtatccaccaaaccagtactgaatgtggccacgagttttcagtaaaccttatcacctaccgaaa

//