LOCUS       NM_001414014            1433 bp    mRNA    linear   ROD 16-OCT-2024
DEFINITION  Mus musculus claudin 6 (Cldn6), transcript variant 2, mRNA.
ACCESSION   NM_001414014 XM_006524641
VERSION     NM_001414014.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1433)
  AUTHORS   Jin,Q., Qi,D., Zhang,M., Qu,H., Dong,Y., Sun,M. and Quan,C.
  TITLE     CLDN6 inhibits breast cancer growth and metastasis through
            SREBP1-mediated RAS palmitoylation
  JOURNAL   Cell Mol Biol Lett 29 (1), 112 (2024)
   PUBMED   39169280
  REMARK    GeneRIF: CLDN6 inhibits breast cancer growth and metastasis through
            SREBP1-mediated RAS palmitoylation.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1433)
  AUTHORS   Zhu,Y., Huang,Y., Tang,T. and Xie,Y.
  TITLE     HDAC1 and HDAC2 orchestrate Wnt signaling to regulate neural
            progenitor transition during brain development
  JOURNAL   iScience 27 (9), 110600 (2024)
   PUBMED   39224519
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1433)
  AUTHORS   Kumar,N., Prakash,P.G., Wentland,C., Kurian,S.M., Jethva,G.,
            Brinkmann,V., Mollenkopf,H.J., Krammer,T., Toussaint,C.,
            Saliba,A.E., Biebl,M., Jurgensen,C., Wiedenmann,B., Meyer,T.F.,
            Gurumurthy,R.K. and Chumduri,C.
  TITLE     Decoding spatiotemporal transcriptional dynamics and epithelial
            fibroblast crosstalk during gastroesophageal junction development
            through single cell analysis
  JOURNAL   Nat Commun 15 (1), 3064 (2024)
   PUBMED   38594232
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1433)
  AUTHORS   Dong,Y., Jin,Q., Sun,M., Qi,D., Qu,H., Wang,X. and Quan,C.
  TITLE     CLDN6 inhibits breast cancer metastasis through WIP-dependent actin
            cytoskeleton-mediated autophagy
  JOURNAL   J Exp Clin Cancer Res 42 (1), 68 (2023)
   PUBMED   36935496
  REMARK    GeneRIF: CLDN6 inhibits breast cancer metastasis through
            WIP-dependent actin cytoskeleton-mediated autophagy.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1433)
  AUTHORS   Gu,R., Zhang,S., Saha,S.K., Ji,Y., Reynolds,K., McMahon,M., Sun,B.,
            Islam,M., Trainor,P.A., Chen,Y., Xu,Y., Chai,Y., Burkart-Waco,D.
            and Zhou,C.J.
  TITLE     Single-cell transcriptomic signatures and gene regulatory networks
            modulated by Wls in mammalian midline facial formation and clefts
  JOURNAL   Development 149 (14) (2022)
   PUBMED   35781558
REFERENCE   6  (bases 1 to 1433)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   7  (bases 1 to 1433)
  AUTHORS   Neidhardt,L., Gasca,S., Wertz,K., Obermayr,F., Worpenberg,S.,
            Lehrach,H. and Herrmann,B.G.
  TITLE     Large-scale screen for genes controlling mammalian embryogenesis,
            using high-throughput gene expression analysis in mouse embryos
  JOURNAL   Mech Dev 98 (1-2), 77-94 (2000)
   PUBMED   11044609
REFERENCE   8  (bases 1 to 1433)
  AUTHORS   Itoh,M., Furuse,M., Morita,K., Kubota,K., Saitou,M. and Tsukita,S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J Cell Biol 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   9  (bases 1 to 1433)
  AUTHORS   Morita,K., Sasaki,H., Furuse,M. and Tsukita,S.
  TITLE     Endothelial claudin: claudin-5/TMVCF constitutes tight junction
            strands in endothelial cells
  JOURNAL   J Cell Biol 147 (1), 185-194 (1999)
   PUBMED   10508865
REFERENCE   10 (bases 1 to 1433)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC154766.2.
            
            On Nov 14, 2022 this sequence version replaced XM_006524641.2.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is essential
            for blastocyst formation in preimplantation mouse embryos, and is
            invloved in and is crucial for the formation and maintenance of the
            epidermal permeability barrier. This gene is adjacent to another
            family member Cldn9 on chromosome 17. [provided by RefSeq, Aug
            2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK337792.1, CN673543.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                AC154766.2         13713-13749         c
            38-1433             AC154766.2         10677-12072         c
FEATURES             Location/Qualifiers
     source          1..1433
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 11.99 cM"
     gene            1..1433
                     /gene="Cldn6"
                     /note="claudin 6"
                     /db_xref="GeneID:54419"
                     /db_xref="MGI:MGI:1859284"
     exon            1..37
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     exon            38..1433
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     CDS             54..713
                     /gene="Cldn6"
                     /note="tight junction molecule claudin 6; skullin"
                     /codon_start=1
                     /product="claudin-6"
                     /protein_id="NP_001400943.1"
                     /db_xref="GeneID:54419"
                     /db_xref="MGI:MGI:1859284"
                     /translation="

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV"

     misc_feature    63..563
                     /gene="Cldn6"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    75..137
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    297..359
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    402..464
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    543..605
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    654..656
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    660..662
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    672..674
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    684..686
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    705..710
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     regulatory      1409..1414
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn6"
                     /note="hexamer: AATAAA"
     polyA_site      1433
                     /gene="Cldn6"
                     /note="major polyA site"
ORIGIN      

actttcgacctggaaatcttagcagtctcttttgcagccccctcaacctcatcatggcctctactggtctgcaaatcttggggatcgtcctgaccctgcttggctgggtcaacgccctggtgtcctgtgccctgcccatgtggaaggtgaccgccttcatcggcaacagcatcgtcgtggcccagatggtgtgggaggggctgtggatgtcctgtgtggttcagagcactggccagatgcagtgcaaggtgtatgactcactgttggcgctgccccaggacctgcaggctgccagagccctctgtgttgtcaccctcctcattgtcctgcttggcctgctcgtgtacctggctggagccaagtgcactacctgtgtggaagataggaactccaagtctcgtctggtgctcatctctggcatcatctttgtcatttctggggtcctgacgctcattcctgtctgctggactgcccactctatcatccaggacttctacaaccccttggtggctgatgctcaaaagcgggagctgggggcctccctctacctgggctgggcagcctcaggccttttgctgctgggtggagggctactatgctgcgcctgctcttctggagggacccagggacccagacattacatggcctgctattctacatctgtcccacattctcggggaccctccgaatatcccaccaagaattatgtgtgatgctcactggggagtgaggctctgctagccagggaacctgagctgagccatcaagaaaggttacggagtagtttgggggttgtcttatttcttgtttttcttttgtactactgggtattgaacctggggccccacgcatttggtaggcaagcactcaccagtgagtcatgtggtgccctgtctgtccctagggtttgttccacctgtttttgagacaagctcttctcatggagctctgatcgacctccagctccagttttcctgcctcaacctgagtccaagctccacctctctctctgctgctggcatttctcacttttagctactgaggctgggaggatgggacacttgagtttctgcgtcattattcattctggggatcttctgtgcagtgttctaaggctgcctggcctttgtttttctcaaaatatcctgtcccagtcccaagagttcctgctgtggccggaggtaactcacaggacagacgcaccccttcctggtcagacttctctccagccctggaagggcaggtgataagttaccaaggaattttctaccctgagacttccaacctttggcccctgaatcccatcgccaaggttactgtgtactctccctacaaaaggtcccagctgtgctgtagaccctcctcccccacaccttgcacacttccctgctcacacaatgctttactaaataaaacatgatttttttttctta

//