GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 02:26:24, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001360728             697 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus interferon induced transmembrane protein 1 (Ifitm1),
            transcript variant 4, mRNA.
ACCESSION   NM_001360728
VERSION     NM_001360728.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 697)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 697)
  AUTHORS   Zhang,X., Yuan,S., Li,H., Zhan,J., Wang,F., Fan,J., Nie,X.,
            Wang,Y., Wen,Z., Chen,Y., Chen,C. and Wang,D.W.
  TITLE     The double face of miR-320: cardiomyocytes-derived miR-320
            deteriorated while fibroblasts-derived miR-320 protected against
            heart failure induced by transverse aortic constriction
  JOURNAL   Signal Transduct Target Ther 6 (1), 69 (2021)
   PUBMED   33597502
  REMARK    GeneRIF: The double face of miR-320: cardiomyocytes-derived miR-320
            deteriorated while fibroblasts-derived miR-320 protected against
            heart failure induced by transverse aortic constriction.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 697)
  AUTHORS   Chal,J., Al Tanoury,Z., Oginuma,M., Moncuquet,P., Gobert,B.,
            Miyanari,A., Tassy,O., Guevara,G., Hubaud,A., Bera,A., Sumara,O.,
            Garnier,J.M., Kennedy,L., Knockaert,M., Gayraud-Morel,B.,
            Tajbakhsh,S. and Pourquie,O.
  TITLE     Recapitulating early development of mouse musculoskeletal
            precursors of the paraxial mesoderm in vitro
  JOURNAL   Development 145 (6) (2018)
   PUBMED   29555813
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 697)
  AUTHORS   Patoine,A., Husseini,A., Kasaai,B., Gaumond,M.H. and Moffatt,P.
  TITLE     The osteogenic cell surface marker BRIL/IFITM5 is dispensable for
            bone development and homeostasis in mice
  JOURNAL   PLoS One 12 (9), e0184568 (2017)
   PUBMED   28880886
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 697)
  AUTHORS   Fu,B., Wang,L., Li,S. and Dorf,M.E.
  TITLE     ZMPSTE24 defends against influenza and other pathogenic viruses
  JOURNAL   J Exp Med 214 (4), 919-929 (2017)
   PUBMED   28246125
REFERENCE   6  (bases 1 to 697)
  AUTHORS   Yang,G., Xu,Y., Chen,X. and Hu,G.
  TITLE     IFITM1 plays an essential role in the antiproliferative action of
            interferon-gamma
  JOURNAL   Oncogene 26 (4), 594-603 (2007)
   PUBMED   16847454
  REMARK    GeneRIF: The antiproliferative action of IFN-gamma requires the
            induction of IFITM1.
REFERENCE   7  (bases 1 to 697)
  AUTHORS   Tanaka,S.S., Yamaguchi,Y.L., Tsoi,B., Lickert,H. and Tam,P.P.
  TITLE     IFITM/Mil/fragilis family proteins IFITM1 and IFITM3 play distinct
            roles in mouse primordial germ cell homing and repulsion
  JOURNAL   Dev Cell 9 (6), 745-756 (2005)
   PUBMED   16326387
REFERENCE   8  (bases 1 to 697)
  AUTHORS   Lickert,H., Cox,B., Wehrle,C., Taketo,M.M., Kemler,R. and
            Rossant,J.
  TITLE     Dissecting Wnt/beta-catenin signaling during gastrulation using RNA
            interference in mouse embryos
  JOURNAL   Development 132 (11), 2599-2609 (2005)
   PUBMED   15857914
  REMARK    GeneRIF: Fragilis2 regulates epithelialization of the somites and
            paraxial mesoderm formation.
REFERENCE   9  (bases 1 to 697)
  AUTHORS   Lange,U.C., Saitou,M., Western,P.S., Barton,S.C. and Surani,M.A.
  TITLE     The fragilis interferon-inducible gene family of transmembrane
            proteins is associated with germ cell specification in mice
  JOURNAL   BMC Dev Biol 3, 1 (2003)
   PUBMED   12659663
REFERENCE   10 (bases 1 to 697)
  AUTHORS   Tanaka,S.S. and Matsui,Y.
  TITLE     Developmentally regulated expression of mil-1 and mil-2, mouse
            interferon-induced transmembrane protein like genes, during
            formation and differentiation of primordial germ cells
  JOURNAL   Mech Dev 119 Suppl 1, S261-S267 (2002)
   PUBMED   14516695
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC162287.4.
            
            Transcript Variant: This variant (4) uses an alternate splice
            junction in the 3' end compared to variant 2, that causes a
            frameshift. The resulting isoform (b) has a shorter and distinct
            C-terminus compared to isoform a.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CA468402.1, ERR2844020.690380.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-363               AC162287.4         146401-146763
            364-697             AC162287.4         147819-148152
FEATURES             Location/Qualifiers
     source          1..697
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 86.2 cM"
     gene            1..697
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /note="interferon induced transmembrane protein 1"
                     /db_xref="GeneID:68713"
                     /db_xref="MGI:MGI:1915963"
     exon            1..363
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    58..60
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /note="upstream in-frame stop codon"
     CDS             181..384
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /note="isoform b is encoded by transcript variant 4;
                     interferon induced transmembrane protein 2 like;
                     fragilis2; fragilis protein 2; ifitm-like protein 2;
                     dispanin subfamily A member 2a"
                     /codon_start=1
                     /product="interferon-induced transmembrane protein 1
                     isoform b"
                     /protein_id="NP_001347657.1"
                     /db_xref="GeneID:68713"
                     /db_xref="MGI:MGI:1915963"
                     /translation="
MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKGQEDGG"
     misc_feature    277..>363
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /note="Interferon-induced transmembrane protein; Region:
                     CD225; pfam04505"
                     /db_xref="CDD:461336"
     exon            364..697
                     /gene="Ifitm1"
                     /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttaactccgcagcccctaaaaagcacaccaaattgtaaacataaggaagtaggtttctgagaaacagaccccactggaggaaaaaggccggcccactgcgcagcaggctccggactgcccagtttgaaaagccttctcattccttccttattctcactctgcagcttcaaaagccgagagatgcctaaggagcagcaagaggtggttgtactggggtcaccccacatctcaacttctgcgacagccaccacaatcaacatgcctgagatctccacgcctgaccatgtggtctggtccctgttcaatacactcttcatgaacttctgctgcctgggcttcgtagcctatgcctactccgtgaagggacaggaagatggtgggtgatacgactggggcccaggccttcgcctccaccgccaagtgcctgaacatcagctccctgttcttcaccatcctcacggccatcgtcgtcatcgttgtctgtgccattagatgatgtgagatgtcttgcaacatctcacagtagataacagattctggggcctcccaggcttgctatgtgtttccttgtctatcgctgccccaaaccctagacttagtcctgaccatttgccccatacatatgcaaatgtgacactcacaaatctgtccatggtggactcaataaagtgcacgtgctgtgactttctgcccctgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]