2025-07-02 10:18:37, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001324534 1018 bp mRNA linear ROD 16-AUG-2024 DEFINITION Mus musculus ribosomal protein L29 (Rpl29), transcript variant 3, mRNA. ACCESSION NM_001324534 VERSION NM_001324534.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1018) AUTHORS Li,H., Huo,Y., He,X., Yao,L., Zhang,H., Cui,Y., Xiao,H., Xie,W., Zhang,D., Wang,Y., Zhang,S., Tu,H., Cheng,Y., Guo,Y., Cao,X., Zhu,Y., Jiang,T., Guo,X., Qin,Y. and Sha,J. TITLE A male germ-cell-specific ribosome controls male fertility JOURNAL Nature 612 (7941), 725-731 (2022) PUBMED 36517592 REFERENCE 2 (bases 1 to 1018) AUTHORS Zhao,Q., Yan,S., Lu,J., Parker,D.J., Wu,H., Sun,Q., Crossman,D.K., Liu,S., Wang,Q., Sesaki,H., Mitra,K., Liu,K. and Jiao,K. TITLE Drp1 regulates transcription of ribosomal protein genes in embryonic hearts JOURNAL J Cell Sci 135 (4) (2022) PUBMED 35099001 REFERENCE 3 (bases 1 to 1018) AUTHORS Ali,M.I., Li,L., Li,L., Yao,L., Liu,J., Gu,W., Huang,S., Wang,B. and Liu,G. TITLE The tissue specific regulation of miR22 expression in the lung and brain by ribosomal protein L29 JOURNAL Sci Rep 10 (1), 16242 (2020) PUBMED 33004906 REMARK GeneRIF: The tissue specific regulation of miR22 expression in the lung and brain by ribosomal protein L29. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1018) AUTHORS Khatter,H., Myasnikov,A.G., Natchiar,S.K. and Klaholz,B.P. TITLE Structure of the human 80S ribosome JOURNAL Nature 520 (7549), 640-645 (2015) PUBMED 25901680 REFERENCE 5 (bases 1 to 1018) AUTHORS Jones,D.T., Lechertier,T., Reynolds,L.E., Mitter,R., Robinson,S.D., Kirn-Safran,C.B. and Hodivala-Dilke,K.M. TITLE Endogenous ribosomal protein L29 (RPL29): a newly identified regulator of angiogenesis in mice JOURNAL Dis Model Mech 6 (1), 115-124 (2013) PUBMED 23118343 REMARK GeneRIF: depletion of Rpl29 using RNA interference inhibited VEGF-induced aortic ring sprouting REFERENCE 6 (bases 1 to 1018) AUTHORS Kirn-Safran,C.B., Julian,J., Fongemie,J.E., Hoke,D.E., Czymmek,K.J. and Carson,D.D. TITLE Changes in the cytologic distribution of heparin/heparan sulfate interacting protein/ribosomal protein L29 (HIP/RPL29) during in vivo and in vitro mouse mammary epithelial cell expression and differentiation JOURNAL Dev Dyn 223 (1), 70-84 (2002) PUBMED 11803571 REMARK GeneRIF: analyzed the expression pattern in the mammary gland especially with respect to luminal epithelial cell growth and differentiation during pregnancy and lactation REFERENCE 7 (bases 1 to 1018) AUTHORS Julian,J., Das,S.K., Dey,S.K., Baraniak,D., Ta,V.T. and Carson,D.D. TITLE Expression of heparin/heparan sulfate interacting protein/ribosomal protein l29 during the estrous cycle and early pregnancy in the mouse JOURNAL Biol Reprod 64 (4), 1165-1175 (2001) PUBMED 11259264 REFERENCE 8 (bases 1 to 1018) AUTHORS Kirn-Safran,C.B., Dayal,S., Martin-DeLeon,P.A. and Carson,D.D. TITLE Cloning, expression, and chromosome mapping of the murine Hip/Rpl29 gene JOURNAL Genomics 68 (2), 210-219 (2000) PUBMED 10964519 REFERENCE 9 (bases 1 to 1018) AUTHORS Hoke,D.E., Regisford,E.G., Julian,J., Amin,A., Begue-Kirn,C. and Carson,D.D. TITLE Murine HIP/L29 is a heparin-binding protein with a restricted pattern of expression in adult tissues JOURNAL J Biol Chem 273 (39), 25148-25157 (1998) PUBMED 9737974 REFERENCE 10 (bases 1 to 1018) AUTHORS Rudert,F., Garnier,J.M. and Schuhbaur,B. TITLE Cloning a pseudogene and cDNA encoding a 17-kDa ribosomal protein from mouse: structure and regulation of expression JOURNAL Gene 133 (2), 249-254 (1993) PUBMED 8224911 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC151729.6. On Dec 14, 2022 this sequence version replaced NM_001324534.1. Transcript Variant: This variant (3) contains an alternate segment in the 5' UTR, compared to variant 1. Variants 1-3 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BI110361.1, BG802990.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-452 AC151729.6 134596-135047 453-517 AC151729.6 135341-135405 518-1018 AC151729.6 136102-136602 FEATURES Location/Qualifiers source 1..1018 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="9" /map="9 57.49 cM" gene 1..1018 /gene="Rpl29" /gene_synonym="Rpl43" /note="ribosomal protein L29" /db_xref="GeneID:19944" /db_xref="MGI:MGI:99687" exon 1..452 /gene="Rpl29" /gene_synonym="Rpl43" /inference="alignment:Splign:2.1.0" misc_feature 386..388 /gene="Rpl29" /gene_synonym="Rpl43" /note="upstream in-frame stop codon" CDS 416..898 /gene="Rpl29" /gene_synonym="Rpl43" /note="60S ribosomal protein L29" /codon_start=1 /product="large ribosomal subunit protein eL29" /protein_id="NP_001311463.1" /db_xref="CCDS:CCDS23476.1" /db_xref="GeneID:19944" /db_xref="MGI:MGI:99687" /translation="
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP"
misc_feature 416..517 /gene="Rpl29" /gene_synonym="Rpl43" /note="propagated from UniProtKB/Swiss-Prot (P47915.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 425..541 /gene="Rpl29" /gene_synonym="Rpl43" /note="Ribosomal L29e protein family; Region: Ribosomal_L29e; pfam01779" /db_xref="CDD:460324" misc_feature 428..430 /gene="Rpl29" /gene_synonym="Rpl43" /note="N6-methyllysine. /evidence=ECO:0000250|UniProtKB:P47914; propagated from UniProtKB/Swiss-Prot (P47915.2); methylation site" misc_feature 506..508 /gene="Rpl29" /gene_synonym="Rpl43" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P47914; propagated from UniProtKB/Swiss-Prot (P47915.2); phosphorylation site" misc_feature 512..514 /gene="Rpl29" /gene_synonym="Rpl43" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P47914; propagated from UniProtKB/Swiss-Prot (P47915.2); acetylation site" misc_feature 758..895 /gene="Rpl29" /gene_synonym="Rpl43" /note="propagated from UniProtKB/Swiss-Prot (P47915.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 794..841 /gene="Rpl29" /gene_synonym="Rpl43" /note="propagated from UniProtKB/Swiss-Prot (P47915.2); Region: 2 X 8 AA tandem repeats of A-X-A-K-A-P-A-[KQ]" misc_feature 827..829 /gene="Rpl29" /gene_synonym="Rpl43" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P47914; propagated from UniProtKB/Swiss-Prot (P47915.2); phosphorylation site" misc_feature 848..850 /gene="Rpl29" /gene_synonym="Rpl43" /note="N6-acetyllysine. /evidence=ECO:0007744|PubMed:23806337; propagated from UniProtKB/Swiss-Prot (P47915.2); acetylation site" exon 453..517 /gene="Rpl29" /gene_synonym="Rpl43" /inference="alignment:Splign:2.1.0" exon 518..1018 /gene="Rpl29" /gene_synonym="Rpl43" /inference="alignment:Splign:2.1.0" regulatory 994..999 /regulatory_class="polyA_signal_sequence" /gene="Rpl29" /gene_synonym="Rpl43" /note="hexamer: AATAAA" polyA_site 1018 /gene="Rpl29" /gene_synonym="Rpl43" /note="major polyA site" ORIGIN
agccgcgggttaccgtgagtgttggccttacggcatccgatgacatccgtgactacagggcggcggcgggtcgcgaggcaggcgacacgggtggcaggaaggacagggcgggcagctgcttggctatggggcatcgagattgccgggcgggggtggttcccggtcgtcctcaaggaacggatggcggggaaagccgccccggggccggcaagctcagtctcaggaccgacctccttgctcgcgtttgagaggtggggtcgcgttttgtgagtgttgccaggctggcgggtgtcgtaaatcggaagcgtctgctgcagcctctggtttcttcatgttaccccagctcagggcggcagaggtgtgccggtctggggaagcccagaactgatctcgtggctttcttgcaggtgcagacatggccaagtccaagaaccacaccacacacaaccagtcccgcaaatggcacagaaatggcatcaagaaaccccggtcgcaaagatacgaatctcttaagggggttgaccccaagttcctgaggaacatgcgctttgccaagaagcacaacaagaaaggcctgaagaagatgcaggccaacaatgcaaaggcagtgagtgcgcgcgcagaggccatcaaggccctggtgaagcctcaggccatcaagcccaagatgccaaaaggccccaaactcaagcggctggctttcatcgctcaccccaagcttgggaagcggattcgaagctacatggccaagggtcagaggctctgccaaccgaagcctaaggtccaaaccaaggcaggggccaaagctccagctaaggcccaggcttcagctccagctcaggctcccaaaggtgctcaggcccccaaaggtgcccaggcccctgtgaaggccccatagaaaaggctcctgccagtgtgaagacagacggactgctgtgacacacctccccacacactatttgcagatgaccagtgtcctatgctgttcttacaaataaactcaggcaagatctgttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]