GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-22 12:02:43, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001324534            1018 bp    mRNA    linear   ROD 21-NOV-2025
DEFINITION  Mus musculus ribosomal protein L29 (Rpl29), transcript variant 3,
            mRNA.
ACCESSION   NM_001324534
VERSION     NM_001324534.2
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1018)
  AUTHORS   Li,H., Huo,Y., He,X., Yao,L., Zhang,H., Cui,Y., Xiao,H., Xie,W.,
            Zhang,D., Wang,Y., Zhang,S., Tu,H., Cheng,Y., Guo,Y., Cao,X.,
            Zhu,Y., Jiang,T., Guo,X., Qin,Y. and Sha,J.
  TITLE     A male germ-cell-specific ribosome controls male fertility
  JOURNAL   Nature 612 (7941), 725-731 (2022)
   PUBMED   36517592
REFERENCE   2  (bases 1 to 1018)
  AUTHORS   Zhao,Q., Yan,S., Lu,J., Parker,D.J., Wu,H., Sun,Q., Crossman,D.K.,
            Liu,S., Wang,Q., Sesaki,H., Mitra,K., Liu,K. and Jiao,K.
  TITLE     Drp1 regulates transcription of ribosomal protein genes in
            embryonic hearts
  JOURNAL   J Cell Sci 135 (4) (2022)
   PUBMED   35099001
REFERENCE   3  (bases 1 to 1018)
  AUTHORS   Kao,B.R., Malerba,A., Lu-Nguyen,N.B., Harish,P., McCarthy,J.J.,
            Dickson,G. and Popplewell,L.J.
  TITLE     Knockdown of Muscle-Specific Ribosomal Protein L3-Like Enhances
            Muscle Function in Healthy and Dystrophic Mice
  JOURNAL   Nucleic Acid Ther 31 (6), 457-464 (2021)
   PUBMED   34081545
REFERENCE   4  (bases 1 to 1018)
  AUTHORS   Ali,M.I., Li,L., Li,L., Yao,L., Liu,J., Gu,W., Huang,S., Wang,B.
            and Liu,G.
  TITLE     The tissue specific regulation of miR22 expression in the lung and
            brain by ribosomal protein L29
  JOURNAL   Sci Rep 10 (1), 16242 (2020)
   PUBMED   33004906
  REMARK    GeneRIF: The tissue specific regulation of miR22 expression in the
            lung and brain by ribosomal protein L29.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1018)
  AUTHORS   Chaillou,T., Zhang,X. and McCarthy,J.J.
  TITLE     Expression of Muscle-Specific Ribosomal Protein L3-Like Impairs
            Myotube Growth
  JOURNAL   J Cell Physiol 231 (9), 1894-1902 (2016)
   PUBMED   26684695
REFERENCE   6  (bases 1 to 1018)
  AUTHORS   Kirn-Safran,C.B., Julian,J., Fongemie,J.E., Hoke,D.E., Czymmek,K.J.
            and Carson,D.D.
  TITLE     Changes in the cytologic distribution of heparin/heparan sulfate
            interacting protein/ribosomal protein L29 (HIP/RPL29) during in
            vivo and in vitro mouse mammary epithelial cell expression and
            differentiation
  JOURNAL   Dev Dyn 223 (1), 70-84 (2002)
   PUBMED   11803571
  REMARK    GeneRIF: analyzed the expression pattern in the mammary gland
            especially with respect to luminal epithelial cell growth and
            differentiation during pregnancy and lactation
REFERENCE   7  (bases 1 to 1018)
  AUTHORS   Julian,J., Das,S.K., Dey,S.K., Baraniak,D., Ta,V.T. and Carson,D.D.
  TITLE     Expression of heparin/heparan sulfate interacting protein/ribosomal
            protein l29 during the estrous cycle and early pregnancy in the
            mouse
  JOURNAL   Biol Reprod 64 (4), 1165-1175 (2001)
   PUBMED   11259264
REFERENCE   8  (bases 1 to 1018)
  AUTHORS   Kirn-Safran,C.B., Dayal,S., Martin-DeLeon,P.A. and Carson,D.D.
  TITLE     Cloning, expression, and chromosome mapping of the murine Hip/Rpl29
            gene
  JOURNAL   Genomics 68 (2), 210-219 (2000)
   PUBMED   10964519
REFERENCE   9  (bases 1 to 1018)
  AUTHORS   Hoke,D.E., Regisford,E.G., Julian,J., Amin,A., Begue-Kirn,C. and
            Carson,D.D.
  TITLE     Murine HIP/L29 is a heparin-binding protein with a restricted
            pattern of expression in adult tissues
  JOURNAL   J Biol Chem 273 (39), 25148-25157 (1998)
   PUBMED   9737974
REFERENCE   10 (bases 1 to 1018)
  AUTHORS   Rudert,F., Garnier,J.M. and Schuhbaur,B.
  TITLE     Cloning a pseudogene and cDNA encoding a 17-kDa ribosomal protein
            from mouse: structure and regulation of expression
  JOURNAL   Gene 133 (2), 249-254 (1993)
   PUBMED   8224911
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC151729.6.
            
            On Dec 14, 2022 this sequence version replaced NM_001324534.1.
            
            Transcript Variant: This variant (3) contains an alternate segment
            in the 5' UTR, compared to variant 1. Variants 1-3 encode the same
            protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI110361.1, BG802990.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-452               AC151729.6         134596-135047
            453-517             AC151729.6         135341-135405
            518-1018            AC151729.6         136102-136602
FEATURES             Location/Qualifiers
     source          1..1018
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 57.49 cM"
     gene            1..1018
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="ribosomal protein L29"
                     /db_xref="GeneID:19944"
                     /db_xref="MGI:MGI:99687"
     exon            1..452
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    386..388
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="upstream in-frame stop codon"
     CDS             416..898
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="60S ribosomal protein L29"
                     /codon_start=1
                     /product="large ribosomal subunit protein eL29"
                     /protein_id="NP_001311463.1"
                     /db_xref="CCDS:CCDS23476.1"
                     /db_xref="GeneID:19944"
                     /db_xref="MGI:MGI:99687"
                     /translation="
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP"
     misc_feature    416..517
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="propagated from UniProtKB/Swiss-Prot (P47915.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    425..541
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="Ribosomal L29e protein family; Region:
                     Ribosomal_L29e; pfam01779"
                     /db_xref="CDD:460324"
     misc_feature    428..430
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="N6-methyllysine.
                     /evidence=ECO:0000250|UniProtKB:P47914; propagated from
                     UniProtKB/Swiss-Prot (P47915.2); methylation site"
     misc_feature    506..508
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P47914; propagated from
                     UniProtKB/Swiss-Prot (P47915.2); phosphorylation site"
     misc_feature    512..514
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P47914; propagated from
                     UniProtKB/Swiss-Prot (P47915.2); acetylation site"
     misc_feature    758..895
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="propagated from UniProtKB/Swiss-Prot (P47915.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    794..841
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="propagated from UniProtKB/Swiss-Prot (P47915.2);
                     Region: 2 X 8 AA tandem repeats of A-X-A-K-A-P-A-[KQ]"
     misc_feature    827..829
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P47914; propagated from
                     UniProtKB/Swiss-Prot (P47915.2); phosphorylation site"
     misc_feature    848..850
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0007744|PubMed:23806337; propagated from
                     UniProtKB/Swiss-Prot (P47915.2); acetylation site"
     exon            453..517
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /inference="alignment:Splign:2.1.0"
     exon            518..1018
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /inference="alignment:Splign:2.1.0"
     regulatory      994..999
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="hexamer: AATAAA"
     polyA_site      1018
                     /gene="Rpl29"
                     /gene_synonym="Rpl43"
                     /note="major polyA site"
ORIGIN      
agccgcgggttaccgtgagtgttggccttacggcatccgatgacatccgtgactacagggcggcggcgggtcgcgaggcaggcgacacgggtggcaggaaggacagggcgggcagctgcttggctatggggcatcgagattgccgggcgggggtggttcccggtcgtcctcaaggaacggatggcggggaaagccgccccggggccggcaagctcagtctcaggaccgacctccttgctcgcgtttgagaggtggggtcgcgttttgtgagtgttgccaggctggcgggtgtcgtaaatcggaagcgtctgctgcagcctctggtttcttcatgttaccccagctcagggcggcagaggtgtgccggtctggggaagcccagaactgatctcgtggctttcttgcaggtgcagacatggccaagtccaagaaccacaccacacacaaccagtcccgcaaatggcacagaaatggcatcaagaaaccccggtcgcaaagatacgaatctcttaagggggttgaccccaagttcctgaggaacatgcgctttgccaagaagcacaacaagaaaggcctgaagaagatgcaggccaacaatgcaaaggcagtgagtgcgcgcgcagaggccatcaaggccctggtgaagcctcaggccatcaagcccaagatgccaaaaggccccaaactcaagcggctggctttcatcgctcaccccaagcttgggaagcggattcgaagctacatggccaagggtcagaggctctgccaaccgaagcctaaggtccaaaccaaggcaggggccaaagctccagctaaggcccaggcttcagctccagctcaggctcccaaaggtgctcaggcccccaaaggtgcccaggcccctgtgaaggccccatagaaaaggctcctgccagtgtgaagacagacggactgctgtgacacacctccccacacactatttgcagatgaccagtgtcctatgctgttcttacaaataaactcaggcaagatctgttag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]