LOCUS       NM_001313698            1356 bp    mRNA    linear   ROD 05-MAY-2025
DEFINITION  Mus musculus B cell receptor associated protein 31 (Bcap31),
            transcript variant 2, mRNA.
ACCESSION   NM_001313698
VERSION     NM_001313698.2
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1356)
  AUTHORS   Zhao,B., An,F., Hao,Z., Zhang,W. and Wang,B.
  TITLE     BAP31 Plays an Essential Role in Mouse B Cell Development via
            Regulation of BCR Signaling
  JOURNAL   Int J Mol Sci 25 (9), 4962 (2024)
   PUBMED   38732181
  REMARK    GeneRIF: BAP31 Plays an Essential Role in Mouse B Cell Development
            via Regulation of BCR Signaling.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1356)
  AUTHORS   Zhao,B., Sun,L., Yuan,Q., Hao,Z., An,F., Zhang,W., Zhu,X. and
            Wang,B.
  TITLE     BAP31 Knockout in Macrophages Affects CD4+T Cell Activation through
            Upregulation of MHC Class II Molecule
  JOURNAL   Int J Mol Sci 24 (17), 13476 (2023)
   PUBMED   37686286
  REMARK    GeneRIF: BAP31 Knockout in Macrophages Affects CD4[+]T Cell
            Activation through Upregulation of MHC Class II Molecule.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1356)
  AUTHORS   Wei,X., Li,L., Zhao,J., Huo,Y., Hu,X., Lu,J., Pi,J., Zhang,W.,
            Xu,L., Yao,Y. and Xu,J.
  TITLE     BAP31 depletion inhibited adipogenesis, repressed lipolysis and
            promoted lipid droplets abnormal growth via attenuating Perilipin1
            proteasomal degradation
  JOURNAL   Int J Biol Sci 19 (6), 1713-1730 (2023)
   PUBMED   37063427
  REMARK    GeneRIF: BAP31 depletion inhibited adipogenesis, repressed
            lipolysis and promoted lipid droplets abnormal growth via
            attenuating Perilipin1 proteasomal degradation.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1356)
  AUTHORS   Li,G., Jiang,X., Liang,X., Hou,Y., Zang,J., Zhu,B., Jia,C., Niu,K.,
            Liu,X., Xu,X., Jiang,R. and Wang,B.
  TITLE     BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB
            pathway in acute lung injury mice model
  JOURNAL   Life Sci 313, 121310 (2023)
   PUBMED   36549351
  REMARK    GeneRIF: BAP31 regulates the expression of ICAM-1/VCAM-1 via
            MyD88/NF-kappaB pathway in acute lung injury mice model.
REFERENCE   5  (bases 1 to 1356)
  AUTHORS   Li,G.X., Jiang,X.H., Zang,J.N., Zhu,B.Z., Jia,C.C., Niu,K.W.,
            Liu,X., Jiang,R. and Wang,B.
  TITLE     B-cell receptor associated protein 31 deficiency decreases the
            expression of adhesion molecule CD11b/CD18 and PSGL-1 in
            neutrophils to ameliorate acute lung injury
  JOURNAL   Int J Biochem Cell Biol 152, 106299 (2022)
   PUBMED   36210579
  REMARK    GeneRIF: B-cell receptor associated protein 31 deficiency decreases
            the expression of adhesion molecule CD11b/CD18 and PSGL-1 in
            neutrophils to ameliorate acute lung injury.
REFERENCE   6  (bases 1 to 1356)
  AUTHORS   Pang,A.L., Taylor,H.C., Johnson,W., Alexander,S., Chen,Y., Su,Y.A.,
            Li,X., Ravindranath,N., Dym,M., Rennert,O.M. and Chan,W.Y.
  TITLE     Identification of differentially expressed genes in mouse
            spermatogenesis
  JOURNAL   J Androl 24 (6), 899-911 (2003)
   PUBMED   14581517
REFERENCE   7  (bases 1 to 1356)
  AUTHORS   Schamel,W.W., Kuppig,S., Becker,B., Gimborn,K., Hauri,H.P. and
            Reth,M.
  TITLE     A high-molecular-weight complex of membrane proteins BAP29/BAP31 is
            involved in the retention of membrane-bound IgD in the endoplasmic
            reticulum
  JOURNAL   Proc Natl Acad Sci U S A 100 (17), 9861-9866 (2003)
   PUBMED   12886015
  REMARK    GeneRIF: A high-molecular-weight complex of membrane proteins
            BAP29/BAP31 is involved in the retention of membrane-bound IgD in
            the endoplasmic reticulum.
REFERENCE   8  (bases 1 to 1356)
  AUTHORS   Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N.,
            Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N.,
            Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R.,
            Thomas,D.Y., Rowley,A. and Bergeron,J.J.
  TITLE     Proteomics characterization of abundant Golgi membrane proteins
  JOURNAL   J Biol Chem 276 (7), 5152-5165 (2001)
   PUBMED   11042173
REFERENCE   9  (bases 1 to 1356)
  AUTHORS   Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B.,
            Nielsen,P.J. and Reth,M.
  TITLE     The specificity of association of the IgD molecule with the
            accessory proteins BAP31/BAP29 lies in the IgD transmembrane
            sequence
  JOURNAL   EMBO J 15 (7), 1534-1541 (1996)
   PUBMED   8612576
REFERENCE   10 (bases 1 to 1356)
  AUTHORS   Kim,K.M., Adachi,T., Nielsen,P.J., Terashima,M., Lamers,M.C.,
            Kohler,G. and Reth,M.
  TITLE     Two new proteins preferentially associated with membrane
            immunoglobulin D
  JOURNAL   EMBO J 13 (16), 3793-3800 (1994)
   PUBMED   8070407
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL805924.5.
            
            On Dec 6, 2023 this sequence version replaced NM_001313698.1.
            
            Transcript Variant: This variant (2) differs in the 5' UTR compared
            to variant 1. Variants 1, 2, and 3 all encode the same isoform (a).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13861890.133063.1,
                                           SRR13422591.87700.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-198               AL805924.5         204553-204750       c
            199-334             AL805924.5         201685-201820       c
            335-435             AL805924.5         199337-199437       c
            436-583             AL805924.5         193889-194036       c
            584-719             AL805924.5         176439-176574       c
            720-840             AL805924.5         175552-175672       c
            841-941             AL805924.5         174729-174829       c
            942-1356            AL805924.5         173073-173487       c
FEATURES             Location/Qualifiers
     source          1..1356
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 37.38 cM"
     gene            1..1356
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="B cell receptor associated protein 31"
                     /db_xref="GeneID:27061"
                     /db_xref="MGI:MGI:1350933"
     exon            1..198
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    69..71
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="upstream in-frame stop codon"
     exon            199..334
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     CDS             243..980
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="isoform a is encoded by transcript variant 2;
                     accessory protein BAP31; p28; BCR-associated protein 31"
                     /codon_start=1
                     /product="B-cell receptor-associated protein 31 isoform a"
                     /protein_id="NP_001300627.1"
                     /db_xref="CCDS:CCDS30209.1"
                     /db_xref="GeneID:27061"
                     /db_xref="MGI:MGI:1350933"
                     /translation="

MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE"

     misc_feature    243..650
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Bap31/Bap29 transmembrane region; Region: Bap31;
                     pfam05529"
                     /db_xref="CDD:461673"
     misc_feature    261..323
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    372..434
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    549..611
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    <642..>953
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="DNA double-strand break repair Rad50 ATPase;
                     Region: PRK02224"
                     /db_xref="CDD:179385"
     misc_feature    732..737
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Cleavage, by caspase-8. /evidence=ECO:0000255;
                     propagated from UniProtKB/Swiss-Prot (Q61335.4); cleavage
                     site"
     misc_feature    816..977
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region:
                     Bap31_Bap29_C; pfam18035"
                     /db_xref="CDD:465623"
     misc_feature    966..977
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     Region: Di-lysine motif"
     exon            335..435
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            436..583
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            584..719
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            720..840
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            841..941
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            942..1356
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1338..1343
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="hexamer: AATAAA"
     polyA_site      1356
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="major polyA site"
ORIGIN      

ctttcgccgtgcctcctctgccactagctccccaaacttgggagagaaggctcgaagcacgttggctgtgaggaacaccaccaggccagcgatggctgagggccaggctgtgccagctcctcgggatcgggcagctcgaaggagagtgtaggaggtcacagccacatccaggagtggcttggtcaggttggaataaaggaaacaagctcccatccctctgttggaaccctttaagtcacaggatgagtttgcagtggactacagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctccaaaaagatggcagaaggtttttaaatcccggctggtggagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtactgttggttattgatgctgtacgagagatcctgaaatacgatgatgtgacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcggccaagaaatacatggaggagaatgatcagctaaagaagggagctgccgaggatggagacaagttggatattgggaatactgaaatgaagttagaggagaacaagagcctgaagaatgacctgaggaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgcctgctagaagaacatgccaaactgcaggcatcagtacgtggtccctcagtcaagaaggaggagtaaaggcttggtgtttccctgcctgccgctggcttctacctgacccatgcttactgcttccttggagcccagactatccctctggtacttgggtttattccctacttccccaattttcttccatggcttatagatcattattttggcaccattacacatactgctcttataccaaaagggacctgattgttgtttattcagagtacttttgccactgttctgcctggctagggcactttccactcctggaagtgtagaaaagcactggtgacctggcctgcagtttgaacccctttttattttgcaatgtaccctaaaggaggctgctgtgaagcaggtcaactgttttatcctgaggggaataaatgttgttatgtta

//