LOCUS       NM_001160099             852 bp    mRNA    linear   ROD 20-MAY-2024
DEFINITION  Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA.
ACCESSION   NM_001160099
VERSION     NM_001160099.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 852)
  AUTHORS   Brideau,G., Cheval,L., Griveau,C., Ling,W.E., Lievre,L.,
            Crambert,G., Muller,D., Brocic,J., Cherchame,E., Houillier,P. and
            Prot-Bertoye,C.
  TITLE     Claudin-10 Expression and the Gene Expression Pattern of Thick
            Ascending Limb Cells
  JOURNAL   Int J Mol Sci 25 (7), 4008 (2024)
   PUBMED   38612818
  REMARK    GeneRIF: Claudin-10 Expression and the Gene Expression Pattern of
            Thick Ascending Limb Cells.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 852)
  AUTHORS   Aure,M.H., Symonds,J.M., Villapudua,C.U., Dodge,J.T., Werner,S.,
            Knosp,W.M. and Hoffman,M.P.
  TITLE     FGFR2 is essential for salivary gland duct homeostasis and
            MAPK-dependent seromucous acinar cell differentiation
  JOURNAL   Nat Commun 14 (1), 6485 (2023)
   PUBMED   37838739
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 852)
  AUTHORS   Winningham,A.H. and Camper,S.A.
  TITLE     Pituitary Stem Cell Regulation by Zeb2 and BMP Signaling
  JOURNAL   Endocrinology 164 (3) (2023)
   PUBMED   36683433
REFERENCE   4  (bases 1 to 852)
  AUTHORS   Quintanova,C., Himmerkus,N., Svendsen,S.L., von Schwerdtner,O.,
            Merkel,C., Pinckert,L., Mutig,K., Breiderhoff,T., Muller,D.,
            Gunzel,D. and Bleich,M.
  TITLE     Unrecognized role of claudin-10b in basolateral membrane infoldings
            of the thick ascending limb
  JOURNAL   Ann N Y Acad Sci 1517 (1), 266-278 (2022)
   PUBMED   35996827
  REMARK    GeneRIF: Unrecognized role of claudin-10b in basolateral membrane
            infoldings of the thick ascending limb.
REFERENCE   5  (bases 1 to 852)
  AUTHORS   Hayashi,T., Eto,K. and Kadoya,Y.
  TITLE     Downregulation of ten-eleven translocation-2 triggers epithelial
            differentiation during organogenesis
  JOURNAL   Differentiation 125, 45-53 (2022)
   PUBMED   35569195
REFERENCE   6  (bases 1 to 852)
  AUTHORS   Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H.,
            Ito,J. and Tsukita,S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear Res 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-10 is expressed at the variety of epithelial
            tissues in the coclea of inner ear including Organ of Corti, stria
            vascularis, Reissner's membrane, and spiral limbus.
REFERENCE   7  (bases 1 to 852)
  AUTHORS   VanBuren,V., Piao,Y., Dudekula,D.B., Qian,Y., Carter,M.G.,
            Martin,P.R., Stagg,C.A., Bassey,U.C., Aiba,K., Hamatani,T.,
            Kargul,G.J., Luo,A.G., Kelso,J., Hide,W. and Ko,M.S.
  TITLE     Assembly, verification, and initial annotation of the NIA mouse
            7.4K cDNA clone set
  JOURNAL   Genome Res 12 (12), 1999-2003 (2002)
   PUBMED   12466305
REFERENCE   8  (bases 1 to 852)
  AUTHORS   Turksen,K. and Troy,T.C.
  TITLE     Permeability barrier dysfunction in transgenic mice overexpressing
            claudin 6
  JOURNAL   Development 129 (7), 1775-1784 (2002)
   PUBMED   11923212
REFERENCE   9  (bases 1 to 852)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 852)
  AUTHORS   Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J Cell Biol 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CK794879.1 and AI851016.1.
            
            Summary: This intronless gene encodes a member of the claudin
            family. Claudins are integral membrane proteins and components of
            tight unction strands. Tight junction strands serve as a physical
            barrier to prevent solutes and water from passing freely through
            the paracellular space between epithelial or endothelial cell
            sheets, and also play critical roles in maintaining cell polarity
            and signal transductions. Six alternatively spliced transcript
            variants have been identified, which encode different isoforms with
            distinct electric charge of the first extracellular loop and with
            or without the fourth transmembrane region. These isoforms exhibit
            distinct localization and function in paracellular anion or cation
            permeability. [provided by RefSeq, Aug 2010].
            
            Transcript Variant: This variant (b_v1) differs in the 5' UTR and
            5' coding region, representing use of an alternate promoter, and
            lacks an alternate in-frame exon in the 3' coding region, compared
            to variant a. The resulting isoform (b_i1) has a longer and
            distinct N-terminus and lacks an internal segment including the
            entire fourth transmembrane region, compared to isoform a. This
            variant is expressed in all tissues tested, with lowest expression
            in liver and highest expression in kidney.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02415122,
                              SAMN02415123 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-504               CK794879.1         1-504
            505-554             CK794879.1         613-662
            555-852             AI851016.1         1-298               c
FEATURES             Location/Qualifiers
     source          1..852
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 62.55 cM"
     gene            1..852
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="claudin 10"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
     exon            1..260
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     CDS             41..628
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="isoform b_i1 is encoded by transcript variant b_v1;
                     claudin-10A; claudin 10B"
                     /codon_start=1
                     /product="claudin-10 isoform b_i1"
                     /protein_id="NP_001153571.1"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
                     /translation="

MASTALEIVAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKICVTDSTGVANCKEFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"

     misc_feature    50..520
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            261..422
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            423..504
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            505..838
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     regulatory      736..741
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: TATAAA"
     polyA_site      756
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
     regulatory      820..825
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: AATAAA"
     polyA_site      838
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="major polyA site"
ORIGIN      

gcgggatcgggaaccagcgagagcgccgctgcagcccagcatggctagcacggccttggaaatcgtcgccttcgtagtctccatctcgggctgggtgctagtgtcttccacactgcccaccgactactggaaggtctccaccatcgatggcactgtcatcaccacagccacttattttgccaacctgtggaagatctgcgttaccgattccaccggtgtcgccaactgcaaggagttcccctccatgctggcgttggatggttacatccaggcatgtagaggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttggaatgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggccgggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaattctttgatcctctttatatggagcaaaaaatgggctacacatacaacggacccacgtctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagctgcctcctgagttttgttgtgcaagagaactgtcctcacaatagtccttccaaggctctcctgtaattactgcttaagctgttttttaaaaatataaatttgaagactgttaattggatgtaaatgttcttatagttatatactaatcattttctgctgtgcctttctgtaagggaaataaacaggttatttacaaaaaaaaaaaaaaa

//