ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-11-23 18:26:43, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_182689 1088 bp mRNA linear PRI 08-JUN-2024
DEFINITION Homo sapiens ephrin A4 (EFNA4), transcript variant 2, mRNA.
ACCESSION NM_182689
VERSION NM_182689.2
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1088)
AUTHORS Yuan,W., Zhao,H., Zhou,A. and Wang,S.
TITLE Interference of EFNA4 suppresses cell proliferation, invasion and
angiogenesis in hepatocellular carcinoma by downregulating PYGO2
JOURNAL Cancer Biol Ther 23 (1), 1-12 (2022)
PUBMED 36404439
REMARK GeneRIF: Interference of EFNA4 suppresses cell proliferation,
invasion and angiogenesis in hepatocellular carcinoma by
downregulating PYGO2.
REFERENCE 2 (bases 1 to 1088)
AUTHORS Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
CONSRTM GenOMICC investigators; 23andMe investigators; COVID-19 Human
Genetics Initiative
TITLE Whole-genome sequencing reveals host factors underlying critical
COVID-19
JOURNAL Nature 607 (7917), 97-103 (2022)
PUBMED 35255492
REFERENCE 3 (bases 1 to 1088)
AUTHORS Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
TITLE Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
spheroid formation by upregulating NANOG expression in oral
squamous cell carcinoma cells
JOURNAL Sci Rep 11 (1), 644 (2021)
PUBMED 33436772
REMARK GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
migration and spheroid formation by upregulating NANOG expression
in oral squamous cell carcinoma cells.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1088)
AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
TITLE A reference map of the human binary protein interactome
JOURNAL Nature 580 (7803), 402-408 (2020)
PUBMED 32296183
REFERENCE 5 (bases 1 to 1088)
AUTHORS Flores,M.A., Fortea,P., Trinidad,E.M., Garcia,D., Soler,G.,
Ortuno,F.J., Zapata,A.G. and Alonso-Colmenar,L.M.
TITLE EphrinA4 plays a critical role in alpha4 and alphaL mediated
survival of human CLL cells during extravasation
JOURNAL Oncotarget 7 (30), 48481-48500 (2016)
PUBMED 27374180
REMARK GeneRIF: Study present for the first time in vitro and in vivo
evidence suggesting that the major role of two ephrin A4 isoforms
in chronic lymphocytic leukemia could be related with a
non-previously described mechanism of survival linked to
extravasation strongly dependent on integrin signaling.
REFERENCE 6 (bases 1 to 1088)
AUTHORS Zhou,R.
TITLE The Eph family receptors and ligands
JOURNAL Pharmacol Ther 77 (3), 151-181 (1998)
PUBMED 9576626
REMARK Review article
REFERENCE 7 (bases 1 to 1088)
AUTHORS Flanagan,J.G. and Vanderhaeghen,P.
TITLE The ephrins and Eph receptors in neural development
JOURNAL Annu Rev Neurosci 21, 309-345 (1998)
PUBMED 9530499
REMARK Review article
REFERENCE 8 (bases 1 to 1088)
AUTHORS Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
Pawson,T., Davis,S. and Yancopoulos,G.D.
TITLE Eph receptors and ligands comprise two major specificity subclasses
and are reciprocally compartmentalized during embryogenesis
JOURNAL Neuron 17 (1), 9-19 (1996)
PUBMED 8755474
REFERENCE 9 (bases 1 to 1088)
AUTHORS Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
Shapiro,D.N. and Morris,S.W.
TITLE The genes encoding the eph-related receptor tyrosine kinase ligands
LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
Epl4) are clustered on human chromosome 1 and mouse chromosome 3
JOURNAL Genomics 33 (2), 277-282 (1996)
PUBMED 8660976
REFERENCE 10 (bases 1 to 1088)
AUTHORS Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
Cerretti,D.P. et al.
TITLE Ligands for the receptor tyrosine kinases hek and elk: isolation of
cDNAs encoding a family of proteins
JOURNAL Oncogene 10 (2), 299-306 (1995)
PUBMED 7838529
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BM740848.1, BE780161.1,
AI459151.1 and BQ940212.1.
On May 31, 2019 this sequence version replaced NM_182689.1.
Summary: This gene encodes a member of the ephrin (EPH) family. The
ephrins and EPH-related receptors comprise the largest subfamily of
receptor protein-tyrosine kinases and have been implicated in
mediating developmental events, especially in the nervous system
and in erythropoiesis. Based on their structures and sequence
relationships, ephrins are divided into the ephrin-A (EFNA) class,
which are anchored to the membrane by a
glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
class, which are transmembrane proteins. This gene encodes an EFNA
class ephrin that has been implicated in proliferation and
metastasis of several types of cancers. [provided by RefSeq, May
2022].
Transcript Variant: This variant (2) uses an alternate splice site
in the 3' coding region, compared to variant 1, that results in a
downstream translation termination. It encodes isoform b which has
a little longer and distinct C-terminus compared to isoform a.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR14038194.4081263.1,
SRR14038192.4003546.1 [ECO:0000332]
##Evidence-Data-END##
##RefSeq-Attributes-START##
coronavirus related :: locus in the vicinity of disease-associated
variant(s)
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-614 BM740848.1 4-617
615-908 BE780161.1 338-631
909-1083 AI459151.1 16-190 c
1084-1088 BQ940212.1 477-481
FEATURES Location/Qualifiers
source 1..1088
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21.3"
gene 1..1088
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="ephrin A4"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
exon 1..197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 1
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571648074"
variation 2
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1056175760"
variation 3
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:539593653"
variation 4
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:949761401"
variation 9
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1044174413"
variation 10
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:905998730"
variation 11
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:941502694"
variation 13..15
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1662879747"
variation 13
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464119917"
variation 14
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1002230"
variation 16
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571648146"
variation 17
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1170853712"
variation 18
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369610690"
variation 21..26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tc"
/replace="tctctc"
/db_xref="dbSNP:964695884"
variation 22
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1182087715"
variation 25
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102437167"
variation 26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:897387079"
variation 28
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881223"
variation 29
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1558137938"
variation 30
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:994855515"
variation 32
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881720"
variation 34
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1433143254"
variation 35
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881992"
variation 40
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662882112"
variation 41
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1322365129"
variation 42
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1365659493"
variation 43
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051079881"
variation 44
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1282376546"
variation 45
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1358327937"
variation 46..48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:1181310223"
variation 46
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662883179"
variation 48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:955424484"
variation 49
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1228436701"
variation 52
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:750018113"
variation 53..62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gccaggccag"
/replace="gccaggccaggccag"
/db_xref="dbSNP:1253948957"
variation 53
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1463310416"
variation 54
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:958220768"
variation 55
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1248187187"
variation 59..60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1662884907"
variation 59
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1219973346"
variation 60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:988198140"
variation 62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:758048320"
variation 64
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779821500"
variation 67
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:914050693"
variation 69
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:946855865"
variation 71
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1163962401"
variation 73
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1411314602"
variation 75
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455908012"
variation 77
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:746766754"
variation 78
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662886993"
variation 84
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1043928491"
CDS 85..708
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="isoform b precursor is encoded by transcript
variant 2; ligand of eph-related kinase 4; eph-related
receptor tyrosine kinase ligand 4"
/codon_start=1
/product="ephrin-A4 isoform b precursor"
/protein_id="NP_872631.1"
/db_xref="CCDS:CCDS44237.1"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
/translation="
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERRARVLPRSPGGGGIPAACTGGANSDRQDGALMGEIRGSEVTLAGACPLITG"
sig_peptide 85..150
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
misc_feature 163..540
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="Ectodomain of Ephrin A; Region:
Ephrin-A_Ectodomain; cd10425"
/db_xref="CDD:259896"
misc_feature 181..183
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (P52798.1); glycosylation site"
misc_feature order(241..243,364..378,403..408,427..444,448..453)
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="receptor binding site [polypeptide binding]; other
site"
/db_xref="CDD:259896"
variation 85
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1662887221"
variation 87
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:754852081"
variation 88
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:926859436"
variation 89
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102437399"
variation 92
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:938282528"
variation 98
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1448650572"
variation 99
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1429093184"
variation 100
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102437421"
variation 101
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1278509153"
variation 107
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1326461416"
variation 108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:780960543"
variation 109
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267248"
variation 112
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1403415249"
variation 113
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662888815"
variation 115
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:891128045"
variation 117
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:12760718"
variation 121
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1349674156"
variation 124
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006894326"
variation 125
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1322354491"
variation 126
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:111269205"
variation 132
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662889826"
variation 133
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1254487338"
variation 134
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:868405546"
variation 137
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1444693034"
variation 138
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662890317"
variation 140
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:968141432"
variation 142
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:771087028"
variation 144
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1157743046"
variation 146
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:865897803"
variation 147
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:774589466"
variation 149
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1471660146"
variation 150
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1184386171"
variation 151
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662891331"
variation 152
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1413024884"
variation 153
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414009017"
variation 154
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:746026404"
variation 155
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:772406343"
variation 157
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1033285451"
variation 158
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662892512"
variation 159
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1197207739"
variation 161
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1232431969"
variation 163
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414753641"
variation 164
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1307352212"
variation 165
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1348498880"
variation 168
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1411162602"
variation 169
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662893318"
variation 171
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:1558138217"
variation 175
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:896160038"
variation 176
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662893722"
variation 177
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1288397903"
variation 178
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:543428198"
variation 181
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:993214956"
variation 183
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1230597690"
variation 186
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1254696715"
variation 187
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1347586578"
variation 188
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1201332848"
variation 189
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:760930080"
variation 190..191
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1662894831"
variation 192
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:764545146"
variation 194
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1227854348"
variation 195
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:776966466"
variation 197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1290688935"
exon 198..484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 198
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054146"
variation 205
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1391062717"
variation 206
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:762225853"
variation 207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054383"
variation 211
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770282147"
variation 213
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773749190"
variation 214
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:745549912"
variation 216
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146980401"
variation 217
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:142249822"
variation 226
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1242749612"
variation 227
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663054982"
variation 233
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1267281203"
variation 236
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927730429"
variation 237
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369664889"
variation 238
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:767156779"
variation 242
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571653198"
variation 243
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:780175061"
variation 244
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1341898292"
variation 251
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1215432400"
variation 252..257
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tg"
/replace="tgtctg"
/db_xref="dbSNP:1466098975"
variation 259
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:752523859"
variation 261
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663055861"
variation 262
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:148289726"
variation 263
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199992371"
variation 265
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1166365914"
variation 267
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:542869546"
variation 268
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:780190233"
variation 277
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2102443103"
variation 278
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370756589"
variation 279
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:781461644"
variation 280..284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/replace="ccccccc"
/db_xref="dbSNP:775997490"
variation 280
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199831867"
variation 281
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199824664"
variation 282
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773661006"
variation 283
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663057149"
variation 284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267556"
variation 285..289
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tgagg"
/db_xref="dbSNP:1663057416"
variation 285
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:764503763"
variation 286
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443149"
variation 288
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663057497"
variation 290
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240867561"
variation 294
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:763481245"
variation 295
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770278541"
variation 296
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:773922536"
variation 298
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:754285540"
variation 299
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201078911"
variation 300
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:541082385"
variation 309
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443179"
variation 310
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1266496575"
variation 313
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138277393"
variation 314
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663058284"
variation 315
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:760519955"
variation 318
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1255181016"
variation 321
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774979817"
variation 324
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:753765092"
variation 326
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:368247612"
variation 327
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:778775987"
variation 328
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:997960767"
variation 329
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1179332137"
variation 330
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1244820785"
variation 331..333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tat"
/replace="tatat"
/db_xref="dbSNP:1413766725"
variation 333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:370806650"
variation 334
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201123791"
variation 335
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663059303"
variation 336
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102443247"
variation 338
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200677884"
variation 340
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663059534"
variation 342
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464802967"
variation 344
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1359699711"
variation 345
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375400864"
variation 347
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663060007"
variation 349
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060083"
variation 350
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="actcata"
/db_xref="dbSNP:1476256817"
variation 351
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060334"
variation 352..353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:1168173419"
variation 353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1431141714"
variation 354..358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/db_xref="dbSNP:758089508"
variation 354
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1004443861"
variation 356
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1407731922"
variation 358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1558139918"
variation 359..361
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:766100897"
variation 359
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:142999275"
variation 362
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1409322528"
variation 364
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1286500741"
variation 365
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061730"
variation 366
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663061841"
variation 368
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061959"
variation 369
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1352621818"
variation 370
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:778114973"
variation 371
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:749698866"
variation 372
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663062544"
variation 373
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1310232406"
variation 374..376
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1663062844"
variation 378
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1416250899"
variation 381
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:544929070"
variation 383..384
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="tt"
/db_xref="dbSNP:866104265"
variation 387
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:953962875"
variation 388..389
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="cctttcgctcc"
/db_xref="dbSNP:1663064354"
variation 388
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064257"
variation 391
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1280989380"
variation 399
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774783548"
variation 403
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:989804173"
variation 405
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663064628"
variation 408
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064704"
variation 409
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064781"
variation 411
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:563226989"
variation 416
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663064999"
variation 417
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:966768645"
variation 420
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1253329399"
variation 424
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368795287"
variation 425
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:775247787"
variation 431
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422554226"
variation 432
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663065651"
variation 433
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:143886639"
variation 434
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663065922"
variation 439
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:776556253"
variation 440
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1256233082"
variation 444
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:761582524"
variation 445
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:765191806"
variation 447
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:750377879"
variation 450
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1372491408"
variation 456
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:114301457"
variation 459
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:767615043"
variation 460
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365701872"
variation 463..464
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1220776337"
variation 469
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067062"
variation 470
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:752848379"
variation 473
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1291203787"
variation 474
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1341436553"
variation 475
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663067363"
variation 476
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:756341656"
variation 477
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:778025181"
variation 479
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067981"
variation 480
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102443491"
variation 482
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1437922306"
variation 484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663068132"
exon 485..553
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 485
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1213932996"
variation 486
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151179474"
variation 487
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663077376"
variation 492
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:41264287"
variation 493
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1464742957"
variation 499
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1187019544"
variation 501
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:764267914"
variation 506
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201670234"
variation 509
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443869"
variation 513
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:757589642"
variation 515
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663077888"
variation 517
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:141223577"
variation 519
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:908106668"
variation 521
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746332488"
variation 522
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:142288768"
variation 525
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1463020576"
variation 528
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663078385"
variation 530
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663078450"
variation 534..536
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1241165316"
variation 534
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663078516"
variation 535
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780776065"
variation 537
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:746489131"
variation 538
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1447360049"
variation 539
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:768333356"
variation 547
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780848551"
exon 554..1088
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 556
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:779807669"
variation 558
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:202246914"
variation 559
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:773440754"
variation 561
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:749132073"
variation 561
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663119892"
variation 562
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1558141212"
variation 563..570
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tcctccca"
/db_xref="dbSNP:771046983"
variation 565
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663120130"
variation 570
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:749435869"
variation 571
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:771274591"
variation 578..579
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:774703301"
variation 579
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:1558141229"
variation 579
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:774753006"
variation 583
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663120523"
variation 585
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1553267706"
variation 586..587
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:746080148"
variation 590
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:759796184"
variation 594
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1472051023"
variation 596
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1158978226"
variation 597
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:767943701"
variation 600
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455615031"
variation 601
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:889300332"
variation 605
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:775818108"
variation 607
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1170496887"
variation 610..614
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggggg"
/replace="gggggg"
/db_xref="dbSNP:772130989"
variation 615
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1402072773"
variation 616
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445698"
variation 619..620
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aa"
/db_xref="dbSNP:775733013"
variation 620
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571655799"
variation 623
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:761244893"
variation 624
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:763533997"
variation 627
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663121737"
variation 628
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1228015744"
variation 629
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1021875220"
variation 631
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:748113318"
variation 633
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663122081"
variation 637..638
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1216183664"
variation 638
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663122196"
variation 643
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:772048174"
variation 648
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1484635748"
variation 652
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:761356922"
variation 654
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:552355758"
variation 655
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1031690866"
variation 657
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:960070810"
variation 661
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:750115905"
variation 667
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:758090033"
variation 678
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:916014726"
variation 679
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1472197427"
variation 680
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:779905284"
variation 681
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1421280494"
variation 683
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1553267728"
variation 684
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1160251060"
variation 686
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:570670486"
variation 689
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:915184543"
variation 691
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1314920375"
variation 696
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123547"
variation 697
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1158480020"
variation 698
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102445821"
variation 699
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123675"
variation 703
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1558141354"
variation 708..714
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aaga"
/replace="aagaaga"
/db_xref="dbSNP:761223567"
variation 709
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1409227720"
variation 716
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:751395056"
variation 720
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663124021"
variation 722
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1375754714"
variation 725
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1204969278"
variation 726
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:754953222"
variation 727
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:781344227"
variation 731
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1345719917"
variation 733
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:749345800"
variation 735..738
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ct"
/replace="ctct"
/db_xref="dbSNP:1226859582"
variation 735
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1382096108"
variation 747
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1280886339"
variation 748
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:771183074"
variation 749
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779226711"
variation 751
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663124751"
variation 752
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746129864"
variation 754
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1057273721"
variation 757..761
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aca"
/replace="acaca"
/db_xref="dbSNP:764734484"
variation 760
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125039"
variation 764
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:981034397"
variation 765
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:909117055"
variation 766
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125260"
variation 768
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1162226299"
variation 774
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1404452992"
variation 779
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102445922"
variation 786
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897335499"
variation 787
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571655973"
variation 791
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:941954387"
variation 799
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:112399433"
variation 800
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571655986"
variation 801
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663125748"
variation 802
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125800"
variation 810..811
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ct"
/db_xref="dbSNP:1237514676"
variation 810
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125846"
variation 811
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:888731911"
variation 812
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:538384115"
variation 813
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006507102"
variation 829
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144763497"
variation 833
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126180"
variation 835
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1219627836"
variation 836
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663126295"
variation 837
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1359075712"
variation 842
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1292506153"
variation 845
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445976"
variation 847
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663126528"
variation 848
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1348896353"
variation 853
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1213257771"
variation 854
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1283668970"
variation 856
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126882"
variation 860
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1487835650"
variation 864
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127059"
variation 866
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897500547"
variation 869
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663127195"
variation 872
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:563813867"
variation 874
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:773104614"
variation 875
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102446017"
variation 876
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663127485"
variation 876
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1051454441"
variation 877
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:374633006"
variation 879
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127614"
variation 883
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365820826"
variation 889
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1164880029"
variation 890
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1417352065"
variation 895..903
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aagaag"
/replace="aagaagaag"
/db_xref="dbSNP:1379195799"
variation 897
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:888902933"
variation 901
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:956725684"
variation 904..906
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:989364734"
variation 905
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1007708289"
variation 906..907
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aggct"
/db_xref="dbSNP:1663128192"
variation 908
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1190413930"
variation 910
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1022239988"
variation 913
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455348952"
variation 919
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:969296951"
variation 921
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663128555"
variation 922
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:904745993"
variation 927
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1224767589"
variation 929
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663128731"
variation 936
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1487333217"
variation 940
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:759728514"
variation 946
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1156430098"
variation 950
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="g"
/db_xref="dbSNP:1663129224"
variation 950
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:564877955"
variation 953
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129286"
variation 958
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129334"
variation 962
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240377298"
variation 963
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1319327545"
variation 967
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663129495"
variation 968
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129542"
variation 970
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:775819390"
variation 971..974
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="actt"
/db_xref="dbSNP:1223300097"
variation 971
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927294280"
variation 972
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129834"
variation 980
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129924"
variation 981
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1304546371"
variation 982
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130022"
variation 989
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:769750020"
variation 990..991
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1663130253"
variation 990
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:536226496"
variation 1001
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130312"
variation 1018
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455222047"
variation 1022
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130422"
variation 1023
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1375872284"
variation 1032
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057458627"
variation 1033
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663130596"
variation 1036
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130642"
variation 1037
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:554241024"
variation 1040
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130752"
variation 1042
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130822"
variation 1043
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1175030350"
variation 1044
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130949"
variation 1045
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1480659387"
variation 1049
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131048"
variation 1050
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:573097675"
regulatory 1055..1060
/regulatory_class="polyA_signal_sequence"
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="hexamer: AATAAA"
variation 1055
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131335"
variation 1056
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663131390"
variation 1057
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:930126542"
variation 1058
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1476999346"
variation 1061
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1261129343"
variation 1069
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663131754"
variation 1071
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663131849"
variation 1073..1078
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ttg"
/replace="ttgttg"
/db_xref="dbSNP:1663131940"
variation 1085
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:540427499"
polyA_site 1088
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="major polyA site"
variation 1088
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1325361549"
ORIGIN
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggagagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]