GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-12-06 11:49:26, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. (1350 bp)
LOCUS XM_018225529 1350 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. ACCESSION XM_018225529 VERSION XM_018225529.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_018225529.2 - Xenopus laevis (African clawed frog) - NCBI
Zea mays homeobox 3 (LOC542440), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 30-APR-2021 DEFINITION Zea mays homeobox 3 (LOC542440), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CABHLF012.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
NM_001309211.1 - Zea mays - NCBI
Zea mays HOX1B protein (LOC732843), mRNA. (2974 bp)
c 1346-2098 EB403344.1 1-753 2099-2974 CABHLF019.1 113510775-113511650 c FEATURES Location/Qualifiers source 1..2974 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /map="6" gene 1..2974 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /note="HOX1B protein" /db_xref="GeneID:732843" exon 1..127 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" exon 128..714 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" misc_feature 242..244 /...
Synonym: GRMZM2G094935; homeobox2; Hox1b
NM_001112448.2 - Zea mays - NCBI
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..798 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 552..724 /gene="MEOX2" /inference="alignment:Splign:2.1.0" exon 725..1891 /gene="...
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 670..1445 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1453) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev Biol 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4) is...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Glycine max homeodomain/HOMEOBOX transcription factor (LOC100797862), mRNA. (1005 bp)
stop codon" CDS 168..884 /gene="LOC100797862" /note="homeobox-leucine zipper protein ATHB-12-like" /codon_start=1 /product="homeodomain/HOMEOBOX transcription factor" /protein_id="NP_001341790.1" /db_xref="GeneID:100797862" /translation="MEYTYSAGVEAETHTSSSTTPSRSKKRNNNTRRFSDEQIKSLETMFESESRLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYGILQSNYNSLASRFEALKKENQTLLIQLQKLNHLMQKPMEPGQRCTQVEAANSMDSESENGGTMKCEAEGKPSPSMEISEHLLGVLSDDDTSIKVEDFGLEDEHGLLNFAKHVDGSLTSPEDWNAFESNDLLGQSTTDDYQWWDFWS" misc_feature 264..416 /gene="LOC100797862" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc...
NM_001354861.1 - Glycine max (soybean) - NCBI
Gallus gallus sensory organ homeobox (SOHO1), mRNA. (1820 bp)
gene="SOHO1" /gene_synonym="SOHO-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(423..425,432..434,552..554,561..566,573..575) /gene="SOHO1" /gene_synonym="SOHO-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 250..1805 /gene="SOHO1" /gene_synonym="SOHO-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1820) AUTHORS Deitcher DL, Fekete DM and Cepko CL. TITLE Asymmetric expression of a novel homeobox gene in vertebrate sensory organs JOURNAL J. Neurosci...
Synonym: SOHO-1
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. (1481 bp)
LOCUS NM_204928 1481 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. ACCESSION NM_204928 VERSION NM_204928.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HLXB9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 577..738 /gene="MNX1" /gene_synonym="HB9; HLXB9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(577..579,586..588,706..708,715..720,727..729) /gene="MNX1" /gene_...
Synonym: HB9; HLXB9
NM_204928.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
reference sequence was derived from JACYVU010000220.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Summary: mouse homolog is a homeobox transcription factor; involved in control of developmental pathways [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" STS...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus ladybird homeobox 2 (LBX2), mRNA. (1072 bp)
gene="LBX2" /gene_synonym="LBX3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(584..586,593..595,713..715,722..727,734..736) /gene="LBX2" /gene_synonym="LBX3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 528..1056 /gene="LBX2" /gene_synonym="LBX3" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1072) AUTHORS Kanamoto T, Terada K, Yoshikawa H and Furukawa T. TITLE Cloning and expression pattern of lbx3, a novel chick homeobox gene JOURNAL Gene Expr. Patterns...
Synonym: LBX3
NM_001044668.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus BARX homeobox 2 (BARX2), mRNA. (927 bp)
LOCUS NM_204896 927 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_204896 VERSION NM_204896.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...BARX2B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 460..621 /gene="BARX2" /gene_synonym="BARX2B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(460..462,469..471,589..591,598..603,610..612) /gene="BARX2" /gene_...
Synonym: BARX2B
NM_204896.1 - Gallus gallus (chicken) - NCBI - UCSC
Gossypium hirsutum homeobox-leucine zipper protein HAT5-like (LOC107897578), mRNA. (765 bp)
HB3" /note="Homeobox associated leucine zipper; Region: HALZ; pfam02183" /db_xref="CDD:280364" exon 1..37 /gene="LOC107897578" /gene_synonym="HB3" /inference="alignment:Splign:2.1.0" exon 38..171 /gene="LOC107897578" /gene_synonym="HB3" /inference="alignment:Splign:2.1.0" exon 172..411 /gene="LOC107897578" /gene_synonym="HB3" /inference="alignment:Splign:2.1.0" exon 412..765 /gene="LOC107897578" /gene_synonym="HB3" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 765) AUTHORS Qin YF, Li DD, Wu YJ, Liu ZH, Zhang J, Zheng Y and Li XB. TITLE Three cotton homeobox genes are...
Synonym: HB3
NM_001326850.1 - Gossypium hirsutum (cotton) - NCBI
Gallus gallus caudal type homeobox 2 (CDX2), mRNA. (1460 bp)
LOCUS NM_204311 1460 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus caudal type homeobox 2 (CDX2), mRNA. ACCESSION NM_204311 VERSION NM_204311.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="CDX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 776..934 /gene="CDX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 750..895 /gene="CDX2" /inference="alignment:Splign:2.1.0" exon 896..1446 /gene="...
NM_204311.1 - Gallus gallus (chicken) - NCBI - UCSC
Zea mays knotted related homeobox 8 (LOC606458), transcript variant 3, mRNA. (1490 bp)
LOCUS NM_001372049 1490 bp mRNA linear PLN 30-APR-2021 DEFINITION Zea mays knotted related homeobox 8 (LOC606458), transcript variant 3, mRNA. ACCESSION NM_001372049 VERSION NM_001372049.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta;...Region: ELK; pfam03789" /db_xref="CDD:367658" misc_feature 928..1047 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:368670" exon 610..721 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /inference...
Synonym: GRMZM2G135447; knox8; knox8a
NM_001372049.1 - Zea mays - NCBI
Gallus gallus ALX homeobox 4 (ALX4), mRNA. (1164 bp)
LOCUS NM_204162 1164 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus ALX homeobox 4 (ALX4), mRNA. ACCESSION NM_204162 VERSION NM_204162.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="ALX4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 586..744 /gene="ALX4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1087..1140 /gene="ALX4" /note="OAR domain; Region: OAR; pfam03826" /db_xref...
NM_204162.1 - Gallus gallus (chicken) - NCBI - UCSC
Macaca mulatta NK6 homeobox 2 (NKX6-2), mRNA. (1018 bp)
LOCUS NM_001266630 1018 bp mRNA linear PRI 22-APR-2021 DEFINITION Macaca mulatta NK6 homeobox 2 (NKX6-2), mRNA. ACCESSION NM_001266630 XM_001092370 VERSION NM_001266630.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata...gene="NKX6-2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 536..697 /gene="NKX6-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(536..538,545..547,665..667,674..679,686..688) /gene="NKX6-2" /note="specific DNA base...
NM_001266630.2 - Macaca mulatta (Rhesus monkey) - NCBI
Gallus gallus mesenchyme homeobox 1 (MEOX1), mRNA. (1931 bp)
LOCUS NM_204765 1931 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus mesenchyme homeobox 1 (MEOX1), mRNA. ACCESSION NM_204765 VERSION NM_204765.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 698..856 /gene="MEOX1" /gene_synonym="GGMOXR1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 645..817 /gene="MEOX1" /gene_synonym="GGMOXR1" /inference="alignment:Splign:2.1.0"...
Synonym: GGMOXR1
NM_204765.1 - Gallus gallus (chicken) - NCBI - UCSC
Glycine max homeobox-leucine zipper protein HAT5-like (LOC100813420), mRNA. (1668 bp)
LOCUS NM_001253281 1668 bp mRNA linear PLN 30-APR-2021 DEFINITION Glycine max homeobox-leucine zipper protein HAT5-like (LOC100813420), mRNA. ACCESSION NM_001253281 XM_003553841 VERSION NM_001253281.2 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae;...gene="LOC100813420" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 710..871 /gene="LOC100813420" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="LOC100813420" /note="...
NM_001253281.2 - Glycine max (soybean) - NCBI
Zea mays knotted related homeobox 8 (LOC606458), transcript variant 1, mRNA. (1619 bp)
LOCUS NM_001372048 1619 bp mRNA linear PLN 30-APR-2021 DEFINITION Zea mays knotted related homeobox 8 (LOC606458), transcript variant 1, mRNA. ACCESSION NM_001372048 VERSION NM_001372048.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta;...Region: ELK; pfam03789" /db_xref="CDD:367658" misc_feature 1240..1359 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:368670" exon 381..783 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /...
Synonym: GRMZM2G135447; knox8; knox8a
NM_001372048.1 - Zea mays - NCBI
Glycine max homeobox associated leucine zipper-containing protein (LOC100499926), mRNA. (1696 bp)
LOCUS NM_001251164 1696 bp mRNA linear PLN 30-APR-2021 DEFINITION Glycine max homeobox associated leucine zipper-containing protein (LOC100499926), mRNA. ACCESSION NM_001251164 XM_006577715 VERSION NM_001251164.2 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota;...gene="LOC100499926" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 481..633 /gene="LOC100499926" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(481..483,601..603,610..615,622..624) /gene="LOC100499926" /note="specific...
NM_001251164.2 - Glycine max (soybean) - NCBI
Gallus gallus distal-less homeobox 1 (DLX1), mRNA. (1059 bp)
LOCUS NM_001045842 1059 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus distal-less homeobox 1 (DLX1), mRNA. ACCESSION NM_001045842 XM_426840 VERSION NM_001045842.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="DLX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 529..690 /gene="DLX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(529..531,538..540,658..660,667..672,679..681) /gene="DLX1" /note="specific DNA base...
NM_001045842.2 - Gallus gallus (chicken) - NCBI - UCSC
Glycine max homeobox-leucine zipper protein HAT22 (LOC100807123), mRNA. (939 bp)
##Evidence-Data-END## FEATURES Location/Qualifiers source 1..939 /organism="Glycine max" /mol_type="mRNA" /cultivar="William 82" /db_xref="taxon:3847" /chromosome="17" /map="17" gene 1..939 /gene="LOC100807123" /note="homeobox-leucine zipper protein HAT22" /db_xref="GeneID:100807123" CDS 1..939 /gene="LOC100807123" /note="homeodomain/HOMEOBOX transcription factor" /codon_start=1 /product="homeobox-leucine zipper protein HAT22" /protein_id="NP_001304594.1" /db_xref="GeneID:100807123" /translation="...
NM_001317665.1 - Glycine max (soybean) - NCBI
Glycine max homeobox-leucine zipper protein ATHB-13-like (LOC100808033), mRNA. (1246 bp)
LOCUS NM_001255337 1246 bp mRNA linear PLN 29-APR-2021 DEFINITION Glycine max homeobox-leucine zipper protein ATHB-13-like (LOC100808033), mRNA. ACCESSION NM_001255337 XM_003518979 VERSION NM_001255337.2 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae;...gene="LOC100808033" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 476..637 /gene="LOC100808033" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(476..478,485..487,605..607,614..619,626..628) /gene="LOC100808033" /note="...
NM_001255337.2 - Glycine max (soybean) - NCBI
Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. (1434 bp)
LOCUS NM_204226 1434 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. ACCESSION NM_204226 VERSION NM_204226.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...misc_feature 280..531 /gene="PKNOX2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature order(862..876,880..882,940..942,958..960,997..999, 1003..1008,1015..1020,1024..1032) /gene="PKNOX2" /note="DNA binding site [nucleotide binding]" /...
NM_204226.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus ladybird homeobox 1 (LBX1), mRNA. (759 bp)
LOCUS NM_001178143 759 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_001178143 VERSION NM_001178143.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="LBX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 389..550 /gene="LBX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(389..391,398..400,518..520,527..532,539..541) /gene="LBX1" /note="specific DNA base...
NM_001178143.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12-like (LOC107946228), mRNA. (1178 bp)
introns" /db_xref="GeneID:107946228" CDS 151..849 /gene="LOC107946228" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="XP_016735956.1" /db_xref="GeneID:107946228" /translation="MEREYHPAADEAIAEQAPQTPRNKKKNKMKKKRRFSDEQIRLLESIFESETKLEPRKKMQLARELELQPRQVAIWFQNRRARWKSKQIEQDYNTLKANYENLESRFESLKKEKHSLILQIQKLSELLEEPHKGGKGLDGSSTSEYGQTKCETEAEVQPSFQHKECLGLQTENERGDIKQTGQGGEEFLIMDEYRNDSPASPDKFYGLHSVDMFDHSYINCQWLNFWT" misc_feature 253..402 /gene="LOC107946228" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 406..534 /gene="...
XM_016880467.2 - Gossypium hirsutum (cotton) - NCBI
Gallus gallus NK2 homeobox 1 (NKX2-1), mRNA. (1779 bp)
="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(505..507,514..516,634..636,643..648,655..657) /gene="NKX2-1" /gene_synonym="NKX2.1; TITF1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" STS 315..477 /gene="NKX2-1" /gene_synonym="NKX2.1; TITF1" /standard_name="Titf1" /db_xref="UniSTS:464797" exon 389..1777 /gene="NKX2-1" /gene_synonym="NKX2.1; TITF1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1779) AUTHORS Pera EM and Kessel M. TITLE Demarcation of ventral territories by the homeobox...
Synonym: NKX2.1; TITF1
NM_204616.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Aquila chrysaetos chrysaetos distal-less homeobox 5 (DLX5), mRNA. (1456 bp)
db_xref="GeneID:115339967" CDS 225..1097 /gene="DLX5" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="XP_029866558.1" /db_xref="GeneID:115339967" /translation="MTGVFDRRVPNIRSGDFQAPFQTAAAMHHPSQESPTLPESSATDSDYYSPAGGAPHGYCSPTSASYGKALNPYQYQYHGMNGSAGNYPAKAYADYSYASPYHQYSGAYNRVQSSASQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHAHAHAHPPNSNPSPASSYLESSASWYPAANSINSHLQPHGSLQHPLALASGTIY" misc_feature 318..578 /gene="DLX5" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD...
XM_030010698.2 - Aquila chrysaetos chrysaetos - NCBI
Gallus gallus homeobox B8 (HOXB8), mRNA. (818 bp)
map="27" /breed="Leghorn" gene 1..818 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="homeobox B8" /db_xref="CGNC:66213" /db_xref="GeneID:395737" exon 1..462 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /inference="alignment:Splign:2.1.0" misc_feature 33..35 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="upstream in-frame stop codon" CDS 42..767 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="homeo box B8; Homeobox protein Hox-2.4" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_990242.1" /db_xref="CGNC:66213" /db_xref="GeneID...
Synonym: CHOX-2.4; Hoxb-8; OX2.4
NM_204911.2 - Gallus gallus (chicken) - NCBI - UCSC
Glycine max homeobox protein knotted-1-like 2-like (LOC100807602), mRNA. (1722 bp)
LOCUS NM_001267070 1722 bp mRNA linear PLN 26-APR-2021 DEFINITION Glycine max homeobox protein knotted-1-like 2-like (LOC100807602), mRNA. ACCESSION NM_001267070 XM_003544461 XM_003544462 XM_003544463 XM_003544464 VERSION NM_001267070.1 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine...gene="LOC100807602" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1163..1282 /gene="LOC100807602" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
NM_001267070.1 - Glycine max (soybean) - NCBI
PREDICTED: Betta splendens Meis homeobox 2a (meis2a), transcript variant X6, mRNA. (1502 bp)
product="homeobox protein Meis2a isoform X5" /protein_id="XP_028995855.1" /db_xref="GeneID:114849021" /translation="MFLYDELAHYGGMDGVPTSMYGDPHAPRPLPQVHHLNHGPPLHASQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 478..732 /gene="meis2a" /note="N-terminal of Homeobox Meis and PKNOX1; Region...
XM_029140022.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens Meis homeobox 2a (meis2a), transcript variant X5, mRNA. (2317 bp)
product="homeobox protein Meis2a isoform X4" /protein_id="XP_028995853.1" /db_xref="GeneID:114849021" /translation="MAQRYDELAHYGGMDGVPTSMYGDPHAPRPLPQVHHLNHGPPLHASQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 1293..1547 /gene="meis2a" /note="N-terminal of Homeobox Meis and PKNOX1;...
XM_029140020.2 - Betta splendens (Siamese fighting fish) - NCBI
Glycine max homeobox-leucine zipper protein ATHB-13-like (LOC100814080), mRNA. (1360 bp)
LOCUS NM_001254957 1360 bp mRNA linear PLN 29-APR-2021 DEFINITION Glycine max homeobox-leucine zipper protein ATHB-13-like (LOC100814080), mRNA. ACCESSION NM_001254957 XM_003517902 VERSION NM_001254957.3 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae;...gene="LOC100814080" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 587..748 /gene="LOC100814080" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" misc_feature order(587..589,596..598,716..718,725..730,737..739) /gene="LOC100814080" /note="...
NM_001254957.3 - Glycine max (soybean) - NCBI
PREDICTED: Betta splendens Meis homeobox 2a (meis2a), transcript variant X3, mRNA. (1524 bp)
product="homeobox protein Meis2a isoform X2" /protein_id="XP_028995852.1" /db_xref="GeneID:114849021" /translation="MFLYDELAHYGGMDGVPTSMYGDPHAPRPLPQVHHLNHGPPLHASQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 479..733 /gene="meis2a" /note="N-terminal of Homeobox Meis and PKNOX1;...
XM_029140019.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens Meis homeobox 2a (meis2a), transcript variant X4, mRNA. (2335 bp)
product="homeobox protein Meis2a isoform X3" /protein_id="XP_028995851.1" /db_xref="GeneID:114849021" /translation="MAQRYDELAHYGGMDGVPTSMYGDPHAPRPLPQVHHLNHGPPLHASQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 1293..1547 /gene="meis2a" /note="N-terminal of Homeobox Meis and...
XM_029140018.2 - Betta splendens (Siamese fighting fish) - NCBI
Gallus gallus iroquois homeobox 1 (IRX1), mRNA. (1404 bp)
LOCUS NM_001030338 1404 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus iroquois homeobox 1 (IRX1), mRNA. ACCESSION NM_001030338 XM_419063 VERSION NM_001030338.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...misc_feature 421..540 /gene="IRX1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" misc_feature 904..957 /gene="IRX1" /note="Motif in Iroquois-class homeodomain proteins (only). Unknown function; Region: IRO; smart00548" /db_xref="CDD:214716" exon 1..264 /gene="...
NM_001030338.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12-like (LOC107911721), mRNA. (1388 bp)
introns" /db_xref="GeneID:107911721" CDS 391..1089 /gene="LOC107911721" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="XP_040955109.1" /db_xref="GeneID:107911721" /translation="MEREYNPAADEAIAEQAPQTPKNKKKNKMKKKRRFSDEQIRLLESIFESETKLEPRKKMQLARELGLQPRQVAIWFQNRRARWKSKQIEQDYNTLKANYDNLESRFESLKKEKHSLILQIQKLSELLEEPHKGGKGLDGSSTSDYGETKCETEVEAQPSFQHKECLGLQTENERGDIKQTGQGGEEFLIMDEYRNDSPASPDKFYGLHSVDMFDHSYTNCQWLNFWT" misc_feature 490..642 /gene="LOC107911721" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_041099175.1 - Gossypium hirsutum (cotton) - NCBI
Rattus norvegicus homeo box C4 (Hoxc4), mRNA. (2068 bp)
synonym="Hox3r3" /inference="alignment:Splign:2.1.0" STS 151..1416 /gene="Hoxc4" /gene_synonym="Hox3r3" /db_xref="UniSTS:491379" misc_feature 356..358 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="upstream in-frame stop codon" CDS 428..1222 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeobox protein R3; Homeobox gene C4" /codon_start=1 /product="homeobox protein Hox-C4" /protein_id="NP_001103354.1" /db_xref="GeneID:24459" /db_xref="RGD:1586210" /translation="...
Synonym: Hox3r3
NM_001109884.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12-like (LOC121223716), mRNA. (1636 bp)
db_xref="GeneID:121223716" CDS 399..1118 /gene="LOC121223716" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="XP_040961892.1" /db_xref="GeneID:121223716" /translation="MLDGEEYREEMGEPFSSVVQVTPTKKKKNKNKRRFSDEQIKSLELMFESETRLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYTILQANYDHLASKYESLKREKQALLAQLQKLNDLIKKPKEEEQCCGQVNGMRCSEGASDKGETTVKSDSEGQLSLSMGRSEHALGALSDDDSAIRTDYFGLEEEPNLMSMVDPADGSLSSPEDWRSLDSDGLFDQSPCGYQWWDFWS" misc_feature 498..650 /gene="LOC121223716" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_041105958.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12 (LOC107941859), mRNA. (1427 bp)
db_xref="GeneID:107941859" CDS 187..906 /gene="LOC107941859" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12" /protein_id="XP_016730971.2" /db_xref="GeneID:107941859" /translation="MLDGEEYREEMGEPFSSVAQVTPTKKKKNKNKRRFSDEQIKSLELMFESETRLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYTILQANYDLLASKYESLKREKQALLTQLQKLNDLIKKPKEEEQCCGQVNGMRCSEGASDKGETTVKSDSEGQLSLSMGRSEHALGALSDDDSAIRTDYFGLEEEPNLMSMVDPADGSLSSPEDWRSLDSDGLFDQSPCGYQWWDFWS" misc_feature 286..438 /gene="LOC107941859" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_016875482.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12-like (LOC107946248), mRNA. (1392 bp)
introns" /db_xref="GeneID:107946248" CDS 326..1030 /gene="LOC107946248" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="XP_016735985.1" /db_xref="GeneID:107946248" /translation="METEYHPAVDEAIAGQAPQIPRNKKMNKLKKKRFSDEQIRLLESIFESETKLEPRKKMQPASELGLQPRQVAIWFQNKRARWKSKQKEQDYNTLKANYDNLESRFESLKKEKQSLILLIQKSSQLLEEPRKGRKGLDGSSTDSKYGENKWETEAEGQPSFQHKECLGLQTENERDDVKQTGQGGEEFLIMDEYRNDSPASPDKFYGLHSTGMFDHSYTNFQWLNFWT" misc_feature 422..574 /gene="LOC107946248" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_016880496.2 - Gossypium hirsutum (cotton) - NCBI
Bos taurus caudal type homeobox 1 (CDX1), mRNA. (1700 bp)
LOCUS NM_001101947 1700 bp mRNA linear MAM 14-MAY-2021 DEFINITION Bos taurus caudal type homeobox 1 (CDX1), mRNA. ACCESSION NM_001101947 XM_589247 VERSION NM_001101947.1 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="CDX1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 554..712 /gene="CDX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 528..673 /gene="CDX1" /inference="alignment:Splign:2.1.0" exon 674..1678 /gene="...
NM_001101947.1 - Bos taurus (cattle) - NCBI
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-7-like (LOC107945900), mRNA. (1064 bp)
db_xref="GeneID:107945900" CDS 76..813 /gene="LOC107945900" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-7-like" /protein_id="XP_016735539.1" /db_xref="GeneID:107945900" /translation="MRSYHIQPQKEDQILVGEYTQRIIEDPFSGMPEITTTKKKNNNKNKRRFSDEQIRSLESMFESESRLEPRKKLEVAKDLGLQPRQVAIWFQNKRARRKSKQLERDYTMLQSNYDNLASKYESLKKEKQALAFQLQKLKDLVKKPKEEDDGQCCGDQQVITMEGEAIKSDSEEQHSFSMERSEHGLGVLSDDDSTIMTSYFELEQEPTSFITMVELGPSGEDWHSFETDGLFDQSSNGYQWWDFWS" misc_feature 217..369 /gene="LOC107945900" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_016880050.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-7-like (LOC107948149), mRNA. (1036 bp)
introns" /db_xref="GeneID:107948149" CDS 180..848 /gene="LOC107948149" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-7-like" /protein_id="XP_016738107.1" /db_xref="GeneID:107948149" /translation="MEDPFSGMPEITTTKKKKNNKNKRRFSDEQIRSLESMFESESRLEPRKKLQVAKDLGLQPRQVAIWFQNKRARRKSKQLERDYTMLQSNYDNLASKYESLKKEKQALAFQLQKLKDLVKKPKEENNGQCCGDQQVITMEGEAIKSDSEEQHSFSMERSEHGLGVLSDDDSTIMTSYFELEQEPTSFITMVELGPGGEDWHSFETDGLFDQSSNGYQWWDFWS" misc_feature 252..404 /gene="LOC107948149" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order...
XM_016882618.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Betta splendens Meis homeobox 2a (meis2a), transcript variant X1, mRNA. (2338 bp)
product="homeobox protein Meis2a isoform X1" /protein_id="XP_040925170.1" /db_xref="GeneID:114849021" /translation="MAQRYDELAHYGGMDGVPTSMYGDPHAPRPLPQVHHLNHGPPLHASQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 1293..1547 /gene="meis2a" /note="N-terminal of Homeobox Meis and...
XM_041069236.1 - Betta splendens (Siamese fighting fish) - NCBI
Macaca mulatta NK3 homeobox 2 (NKX3-2), mRNA. (2387 bp)
LOCUS NM_001194111 2387 bp mRNA linear PRI 15-MAY-2021 DEFINITION Macaca mulatta NK3 homeobox 2 (NKX3-2), mRNA. ACCESSION NM_001194111 XM_001098720 VERSION NM_001194111.1 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata...gene="NKX3-2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 846..1007 /gene="NKX3-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(846..848,855..857,975..977,984..989,996..998) /gene="NKX3-2" /note="specific DNA base...
NM_001194111.1 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Pyrgilauda ruficollis Meis homeobox 1 (MEIS1), transcript variant X1, mRNA. (3008 bp)
product="homeobox protein Meis1 isoform X1" /protein_id="XP_041332932.1" /db_xref="GeneID:121358626" /translation="MTCRHYDELPHYGGMEGVGIPTTMYGDPHGARPMQPVHHLNHGPPLHSHQYPHAAHANAMPPAMGASVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM" misc_feature 557..811 /gene="MEIS1" /note="N-terminal of Homeobox Meis and PKNOX1; Region:...
XM_041476998.1 - Pyrgilauda ruficollis (rufous-necked snowfinch) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/homeobox
lang : ja | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.402 | 0.402 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.761 | 0.360 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.767 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]