GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-01 22:38:34, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_046906228             475 bp    mRNA    linear   VRT 01-MAR-2022
DEFINITION  PREDICTED: Gallus gallus U1 small nuclear ribonucleoprotein A-like
            (LOC121108975), mRNA.
ACCESSION   XM_046906228
VERSION     XM_046906228.1
DBLINK      BioProject: PRJNA698609
KEYWORDS    RefSeq; corrected model.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024096096.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gallus gallus Annotation Release 106
            Annotation Version          :: 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-40                JAENSK010000669.1  2782-2821           c
            41-122              JAENSK010000669.1  2420-2501           c
            123-295             JAENSK010000669.1  1642-1814           c
            296-310             JAENSK010000669.1  260-274             c
            311-311             "N"                1-1
            312-475             JAENSK010000669.1  96-259              c
FEATURES             Location/Qualifiers
     source          1..475
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /isolate="bGalGal1"
                     /db_xref="taxon:9031"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /country="USA: Fayetteville"
                     /lat_lon="36.0822 N 94.1719 W"
                     /collection_date="20-May-2019"
                     /collected_by="Nick Anthony"
     gene            1..475
                     /gene="LOC121108975"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 long SRA reads, 1 Protein, and 99%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 91 samples with support for all
                     annotated introns"
                     /db_xref="CGNC:88847"
                     /db_xref="GeneID:121108975"
     misc_feature    1
                     /gene="LOC121108975"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             50..472
                     /gene="LOC121108975"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: U1 small nuclear
                     ribonucleoprotein A-like"
                     /protein_id="XP_046762184.1"
                     /db_xref="GeneID:121108975"
                     /db_xref="CGNC:88847"
                     /translation="
MAVQEARPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEMGSATNALRSMQGFPFYDKPMRIQYAXTDSDIIAKMKGTFVERDRKREKRKPKGSDAPPPKKNPPPGAAAPVRKAQSSH"
     misc_feature    68..334
                     /gene="LOC121108975"
                     /note="RNA recognition motif 1 (RRM1) found in vertebrate
                     U1 small nuclear ribonucleoprotein A (U1A); Region:
                     RRM1_U1A; cd12477"
                     /db_xref="CDD:409906"
     misc_feature    order(86..88,92..97,104..106,179..181,185..187,191..211,
                     215..217,287..289,296..298,302..325)
                     /gene="LOC121108975"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:409906"
ORIGIN      
gggcgggcacaacgcgcgaggcgcgagcgaagaggaggcgcgcagagcaatggcggtgcaggaggcgcgtcccaaccacaccatttacatcaataacctgaacgagaagatcaagaaggatgagctgaagaagtcgctgtacgccatcttctcgcagttcgggcagatcctggacatcctggtgtcccgcagcctgaagatgagggggcaggccttcgtcatcttcaaggagatgggcagcgccaccaacgcgctgcgctccatgcagggcttccccttctacgacaagcccatgcgcatccaatacgccnaaacggactcagacatcatagccaaaatgaagggcacttttgtggagcgcgaccggaagagggagaaaaggaaacccaaagggagcgacgccccccccccaaaaaagaacccccccccgggggcggccgcaccggtacggaaagctcagagcagccattaatgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]