GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-21 06:56:46, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_205331               1237 bp    mRNA    linear   VRT 26-JUN-2025
DEFINITION  Gallus gallus goosecoid homeobox (GSC), mRNA.
ACCESSION   NM_205331
VERSION     NM_205331.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1237)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1237)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1237)
  AUTHORS   Izpisua-Belmonte,J.C., De Robertis,E.M., Storey,K.G. and Stern,C.D.
  TITLE     The homeobox gene goosecoid and the origin of organizer cells in
            the early chick blastoderm
  JOURNAL   Cell 74 (4), 645-659 (1993)
   PUBMED   7916659
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000215.1.
            
            On Nov 5, 2021 this sequence version replaced NM_205331.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: HAEL01004953.1, X70471.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992415, SAMEA103992428
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-656               JAENSK010000215.1  16189404-16190059   c
            657-916             JAENSK010000215.1  16189041-16189300   c
            917-1237            JAENSK010000215.1  16188431-16188751   c
FEATURES             Location/Qualifiers
     source          1..1237
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /map="5"
     gene            1..1237
                     /gene="GSC"
                     /note="goosecoid homeobox"
                     /db_xref="CGNC:8338"
                     /db_xref="GeneID:396273"
     exon            1..656
                     /gene="GSC"
                     /inference="alignment:Splign:2.1.0"
     CDS             329..1069
                     /gene="GSC"
                     /codon_start=1
                     /product="homeobox protein goosecoid"
                     /protein_id="NP_990662.2"
                     /db_xref="CGNC:8338"
                     /db_xref="GeneID:396273"
                     /translation="
MPASMFSIDNILAARPRCKDSVLLPPSAAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGGSRLGYNNYYYGQLHVPTSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS"
     misc_feature    782..952
                     /gene="GSC"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    938..1066
                     /gene="GSC"
                     /note="propagated from UniProtKB/Swiss-Prot (P53545.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            657..916
                     /gene="GSC"
                     /inference="alignment:Splign:2.1.0"
     exon            917..1237
                     /gene="GSC"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atactccgtgcagccctccgggctgagatcagtaaacaggcgcgagtcgaggggggaaagttccaggggtggatcctgcgcgcacacacacagacacacacacacgcacacacatagacacacgcatacgcatgcacgcacactctgccctattgctgccctcggaaaaggctccgctcctttctctccgatccctttccaaaatttctcccgaaagtttcgatttcgcgtctcttcagcttcccccctcccctccaccgccgccactgccgccgcggccgccggcagcacctccctcccccggccggtccccggcccgcgttggggcatgcctgcgagcatgttcagcatcgacaacatcctggcggccagacctcgctgcaaggactcggtgctgctgcccccgagcgccgcgcccgtcgtcttccccagcctgcacggggactccctctacggcgctgcctccgactacggaggattttactcccgggctgtggctcccggctcggcgctgccggcggtcggcggctcccgcctgggctacaacaactactactacgggcagctgcatgtgcccacgtctcccgtgggcccgtcgtgttgcggggccgtgccgccgctgggggcccagcagtgctcctgcgtgccccccgcaggttacgagggcgctgggtcggtgctgatgtcccctgttccccatcagatgttgccctacatgaacgtaggcactttgtcccggacggagctgcagttactcaaccagctgcactgcaggcggaaaagacggcaccggactatcttcactgacgagcagctcgaagcgctggaaaacctcttccaggaaacgaaatacccagacgtgggcaccagggaacagctggcgaggagggtgcacttaagagaggagaaagtggaggtttggttcaaaaaccgccgggcgaaatggaggaggcaaaagcggtcgtcttccgaggagtcggaaaatgcacagaaatggaataaagcgtctaaaacgtctccggagaagaggcaagaagacgggaaaagcgatttggactccgacagctgatgccgcgcagggggatgctccccgtggactgtaggatacgctccggaggatgctactatcttgcacaagctctgccttgtcggagggggaaactatctgtatataatgtacaataccccgagtcgatttcgtgtaaataaaatgtgttgcggaggtgttgcacaggca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]