2025-07-03 11:52:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_205331 1237 bp mRNA linear VRT 06-AUG-2024 DEFINITION Gallus gallus goosecoid homeobox (GSC), mRNA. ACCESSION NM_205331 VERSION NM_205331.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1237) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1237) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1237) AUTHORS Izpisua-Belmonte,J.C., De Robertis,E.M., Storey,K.G. and Stern,C.D. TITLE The homeobox gene goosecoid and the origin of organizer cells in the early chick blastoderm JOURNAL Cell 74 (4), 645-659 (1993) PUBMED 7916659 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000215.1. On Nov 5, 2021 this sequence version replaced NM_205331.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: HAEL01004953.1, X70471.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992415, SAMEA103992428 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-656 JAENSK010000215.1 16189404-16190059 c 657-916 JAENSK010000215.1 16189041-16189300 c 917-1237 JAENSK010000215.1 16188431-16188751 c FEATURES Location/Qualifiers source 1..1237 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="5" /map="5" gene 1..1237 /gene="GSC" /note="goosecoid homeobox" /db_xref="CGNC:8338" /db_xref="GeneID:396273" exon 1..656 /gene="GSC" /inference="alignment:Splign:2.1.0" CDS 329..1069 /gene="GSC" /codon_start=1 /product="homeobox protein goosecoid" /protein_id="NP_990662.2" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="
MPASMFSIDNILAARPRCKDSVLLPPSAAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGGSRLGYNNYYYGQLHVPTSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS"
misc_feature 782..952 /gene="GSC" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 938..1066 /gene="GSC" /note="propagated from UniProtKB/Swiss-Prot (P53545.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 657..916 /gene="GSC" /inference="alignment:Splign:2.1.0" exon 917..1237 /gene="GSC" /inference="alignment:Splign:2.1.0" ORIGIN
atactccgtgcagccctccgggctgagatcagtaaacaggcgcgagtcgaggggggaaagttccaggggtggatcctgcgcgcacacacacagacacacacacacgcacacacatagacacacgcatacgcatgcacgcacactctgccctattgctgccctcggaaaaggctccgctcctttctctccgatccctttccaaaatttctcccgaaagtttcgatttcgcgtctcttcagcttcccccctcccctccaccgccgccactgccgccgcggccgccggcagcacctccctcccccggccggtccccggcccgcgttggggcatgcctgcgagcatgttcagcatcgacaacatcctggcggccagacctcgctgcaaggactcggtgctgctgcccccgagcgccgcgcccgtcgtcttccccagcctgcacggggactccctctacggcgctgcctccgactacggaggattttactcccgggctgtggctcccggctcggcgctgccggcggtcggcggctcccgcctgggctacaacaactactactacgggcagctgcatgtgcccacgtctcccgtgggcccgtcgtgttgcggggccgtgccgccgctgggggcccagcagtgctcctgcgtgccccccgcaggttacgagggcgctgggtcggtgctgatgtcccctgttccccatcagatgttgccctacatgaacgtaggcactttgtcccggacggagctgcagttactcaaccagctgcactgcaggcggaaaagacggcaccggactatcttcactgacgagcagctcgaagcgctggaaaacctcttccaggaaacgaaatacccagacgtgggcaccagggaacagctggcgaggagggtgcacttaagagaggagaaagtggaggtttggttcaaaaaccgccgggcgaaatggaggaggcaaaagcggtcgtcttccgaggagtcggaaaatgcacagaaatggaataaagcgtctaaaacgtctccggagaagaggcaagaagacgggaaaagcgatttggactccgacagctgatgccgcgcagggggatgctccccgtggactgtaggatacgctccggaggatgctactatcttgcacaagctctgccttgtcggagggggaaactatctgtatataatgtacaataccccgagtcgatttcgtgtaaataaaatgtgttgcggaggtgttgcacaggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]