ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 14:19:11, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_205293 1404 bp mRNA linear VRT 30-APR-2025 DEFINITION Gallus gallus homeobox B4 (HOXB4), mRNA. ACCESSION NM_205293 XM_001235893 VERSION NM_205293.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1404) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1404) AUTHORS Attia,L., Yelin,R. and Schultheiss,T.M. TITLE Analysis of nephric duct specification in the avian embryo JOURNAL Development 139 (22), 4143-4151 (2012) PUBMED 23034630 REMARK GeneRIF: In the primitive streak, expression of the gene HoxB4 is associated with prospective duct IM, whereas expression of the more posterior Hox gene HoxA6 is associated with more posterior, non-duct-forming IM. REFERENCE 3 (bases 1 to 1404) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1404) AUTHORS Amirthalingam,G.S., Howard,S., Alvarez,S., de Lera,A.R. and Itasaki,N. TITLE Regulation of Hoxb4 induction after neurulation by somite signal and neural competence JOURNAL BMC Dev Biol 9, 17 (2009) PUBMED 19243620 REMARK GeneRIF: Study shows that somites are required for the up-regulation of Hoxb4 in the neural tube at the level of somites 1 to 5, the anterior-most domain of expression. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1404) AUTHORS Sasaki,H. and Kuroiwa,A. TITLE The nucleotide sequence of the cDNA encoding a chicken Deformed family homeobox gene, Chox-Z JOURNAL Nucleic Acids Res 18 (1), 184 (1990) PUBMED 1968620 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000364.1. On Dec 3, 2021 this sequence version replaced NM_205293.2. ##Evidence-Data-START## Transcript exon combination :: BU334053.1, SRR13267655.5054.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-705 JAENSK010000364.1 756527-757231 706-1404 JAENSK010000364.1 758015-758713 FEATURES Location/Qualifiers source 1..1404 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="27" /map="27" gene 1..1404 /gene="HOXB4" /gene_synonym="Chox-Z" /note="homeobox B4" /db_xref="CGNC:15553" /db_xref="GeneID:396230" exon 1..705 /gene="HOXB4" /gene_synonym="Chox-Z" /inference="alignment:Splign:2.1.0" misc_feature 174..176 /gene="HOXB4" /gene_synonym="Chox-Z" /note="upstream in-frame stop codon" CDS 285..1022 /gene="HOXB4" /gene_synonym="Chox-Z" /note="homeo box B4; homeobox protein Hox-Z" /codon_start=1 /product="homeobox protein Hox-B4" /protein_id="NP_990624.1" /db_xref="CGNC:15553" /db_xref="GeneID:396230" /translation="
MAMSSFLINSNYVDPKFPPCEEYSHSDYLPNHSPEYYSSQRRESTFQHEAMYQPRSACSEQLYPSCQSSGHQAAVLSPRGHVHPPAGLQSHLSEPNHPCEPGTPSPPPSCSQNSLNQSPSNSSCKEPVVYPWMKKVHVSTVNPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHSLCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSNPSSSSASLQIPPAASQSRSSGPASSL"
misc_feature 735..905
/gene="HOXB4"
/gene_synonym="Chox-Z"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 706..1404
/gene="HOXB4"
/gene_synonym="Chox-Z"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcggggcccggggaacggggccggaggggagcgggcgcccccggccgcctccccggggatgctccgggccccgggagagcccgtgccgggcagatttccttatccggggatcgcaggccacctcgccattggcccgcgctgtcacatggactccaactttgttcacttgacagtaagtaggagggtttcacgaaacaggaaaacgagtaaagggggggacaggaataaattttaggaaatatatatatatatatatttttcgtgtgtgcaattctaagaaattaatggccatgagctcgtttttgatcaactccaactatgtggaccccaagttcccaccctgtgaagagtattcccacagcgattaccttcccaatcactcgccggaatattacagcagccagaggcgagagagcactttccaacatgaagcgatgtaccagccgcggtcagcatgcagcgagcagctctacccgtcctgtcagagctccgggcaccaagcagcggtgttatccccccggggtcatgtccatcctccggccggactgcagagccatctctctgagccaaaccatccctgcgagccgggcacccccagccctccaccctcctgcagccaaaactctctgaaccaaagcccttccaattcctcttgcaaagagccggtagtttacccctggatgaaaaaagtccatgtaagcacggtaaaccccaattattcaggaggggaaccgaaacgttcgcgcacagcctacaccaggcagcaggtcctggagctggagaaggaattccactataaccgctatctcacccggaggcggagggtcgaaatcgcccattctctgtgcctctccgagcgccagatcaaaatctggttccagaacaggaggatgaaatggaagaaagaccacaagttacccaacaccaagatcaggtccaacccttccagctcctccgccagcctgcagatcccaccggcagcttctcaaagccgatccagcggaccagccagcagcctataactattccctgtatggacggggtgtgcgtgctcgtgggtgtgattgtgagtgtgagtgtgtgtagggaacacgggagaatagtggggtttttttaatgctccgagaagcgaaggaaggaggggggctttttttatttataaggggcaacagggagaggctcagctccaacaaagcagagccgtgctgctgtgcccctcttccattagaagaaggctgtaggtagtagttttcagatttggctaagatggatccttgtttcatctttaatcacgccaagctctgccccatttgtcatgtttactctcccgtacaaaggatggaccttatgtctgctattacctcgacaaccagcgttcactttaataaatgaggctcagtttct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]