LOCUS       NM_001396684            1789 bp    mRNA    linear   VRT 13-OCT-2024
DEFINITION  Gallus gallus ISL LIM homeobox 2 (ISL2), transcript variant 1,
            mRNA.
ACCESSION   NM_001396684 XM_015279026 XM_040680536
VERSION     NM_001396684.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1789)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1789)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1789)
  AUTHORS   Moret,F., Renaudot,C., Bozon,M. and Castellani,V.
  TITLE     Semaphorin and neuropilin co-expression in motoneurons sets axon
            sensitivity to environmental semaphorin sources during motor axon
            pathfinding
  JOURNAL   Development 134 (24), 4491-4501 (2007)
   PUBMED   18039974
REFERENCE   4  (bases 1 to 1789)
  AUTHORS   Sockanathan,S. and Jessell,T.M.
  TITLE     Motor neuron-derived retinoid signaling specifies the subtype
            identity of spinal motor neurons
  JOURNAL   Cell 94 (4), 503-514 (1998)
   PUBMED   9727493
REFERENCE   5  (bases 1 to 1789)
  AUTHORS   Tsuchida,T., Ensini,M., Morton,S.B., Baldassare,M., Edlund,T.,
            Jessell,T.M. and Pfaff,S.L.
  TITLE     Topographic organization of embryonic motor neurons defined by
            expression of LIM homeobox genes
  JOURNAL   Cell 79 (6), 957-970 (1994)
   PUBMED   7528105
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000245.1.
            
            On or before Oct 25, 2021 this sequence version replaced
            XM_015279026.3, XM_040680536.1.
            
            Transcript Variant: This variant (1) has 6 exons. The fifth exon is
            the long variant.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns
                              SAMEA103992290, SAMEA103992440 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-184               JAENSK010000245.1  2913317-2913500     c
            185-374             JAENSK010000245.1  2912326-2912515     c
            375-625             JAENSK010000245.1  2911970-2912220     c
            626-909             JAENSK010000245.1  2911532-2911815     c
            910-1080            JAENSK010000245.1  2911285-2911455     c
            1081-1789           JAENSK010000245.1  2910484-2911192     c
FEATURES             Location/Qualifiers
     source          1..1789
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="10"
                     /map="10"
     gene            1..1789
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="ISL LIM homeobox 2"
                     /db_xref="CGNC:49781"
                     /db_xref="GeneID:396382"
     exon            1..184
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     CDS             127..1197
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="domesticus (clone 1.6 kB) islet-2"
                     /codon_start=1
                     /product="insulin gene enhancer protein ISL-2"
                     /protein_id="NP_001383613.1"
                     /db_xref="CGNC:49781"
                     /db_xref="GeneID:396382"
                     /translation="

MVDILLPRPLPSAMGEPAKRRPGLALCAGCGGRIQDPFLLRVSPDLEWHVACLKCAECGQPLDETCTCFLRDGKAYCKRDYGRLFGIKCAQCRAAFSSSDLVMRARDHVYHLECFRCAACGRQLLPGDQFCLRERDLLCRADHGPPPDGAAARGPRSPAPPPAHLAEPVPGRPPGPRPQSHKAAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPVRHESAVQGSAVEVQTYQPPWKALSDFALQSDLEPPAAFQQLVSFSESGSLGTSSGSDVTSLSSQLPDTPNSMVPSPAET"

     misc_feature    205..369
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="The first LIM domain of Isl, a member of LHX
                     protein family; Region: LIM1_Isl; cd09366"
                     /db_xref="CDD:188752"
     misc_feature    order(205..207,214..216,271..273,280..282,289..291,
                     298..300,355..357,364..366)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188752"
     misc_feature    391..555
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="The second LIM domain of Isl2; Region: LIM2_Isl2;
                     cd09471"
                     /db_xref="CDD:188855"
     misc_feature    order(391..393,400..402,457..459,466..468,475..477,
                     484..486,541..543,550..552)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188855"
     misc_feature    685..855
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(691..702,706..708,757..759,775..777,814..816,
                     820..825,832..837,841..849,853..858)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(694..696,703..705,823..825,832..837,844..846)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            185..374
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            375..625
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            626..909
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            910..1080
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            1081..1789
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gctgcccggcggggcgggcccgggggggcgggcgcggcccccgccccgcgcggagcgggtagtggtggagcggcggcgccgcgtcccgcatcgcgcatcgccgccggtgcgcacggggccgcccgcatggtggacatcctcctgccgcggccgctcccgagcgccatgggggagcccgccaagagacggccggggctggcgctgtgcgcgggctgcggcggccgcatccaggacccgttcctgctgcgggtgtctccggacctggagtggcacgtcgcctgcctcaagtgcgccgagtgcgggcagccgctggacgagacctgcacgtgcttcctgcgcgacggcaaggcctactgcaagcgggactacggcaggctcttcggcatcaagtgcgcgcagtgccgggcggccttcagcagcagcgacctggtgatgcgcgcccgcgaccacgtctaccacctggagtgcttccgctgcgccgcctgcggccgccagctgctgcccggggatcagttctgcctgcgggagcgcgacctgctctgccgcgccgaccacgggccgccccccgacggcgccgccgcccgcgggccccgcagccccgcgccgccgcccgcgcacctcgcagagccggtgcccggacggccgcccggcccgcggccgcagtcgcacaaagcggccgagaagaccacccgcgtgcggacggtgctgaacgagaagcagctgcacacgctgcggacctgctacgccgccaacccgagacccgacgccctgatgaaggagcagctggtggagatgacggggctcagcccgcgcgtcatccgcgtctggttccagaacaagcgctgcaaggacaagaagaagtccatcctcatgaagcagctccagcagcagcagcacagcgacaagacgagcctgcagggcctcaccgggacgccgctggtggccggcagccccgtccggcacgagagcgccgtgcagggcagcgcggtggaggtgcagacctaccagccgccctggaaggcgctcagcgacttcgcgctgcagagcgacctggagccgcccgccgccttccagcagctggtctccttctccgagtccggctctttgggcacgtcctccggcagcgacgtgacctcgctgtcctcccagctccccgacacccccaacagcatggtgcccagcccggccgagacgtgaggccgcccggcccccgccgccgcgggacctccgcatgccgcgctccctgcatgagacacccggccccgcgccgcgcccagcgcgccggacgagcgcctttgtcttttaattattcctatttaaaaccaaaccgaacgtaccttgccgacggccgaaaagcgccgggattctcgctgccttcaccggaccggagagagaaagagagagcgagcccccgccccgctcatttcgttgcgcggaggttcggcgctgcggatttcgatgtttcttttccgcgatgaaagcggattgcccggcggggcgccggctcttcctcctcgcctggaacagaaacgaaaactcgaatcaaaccgaacgggggtcggagccccgcggccgtcgcggccgcctcacgccggcgcctcccgcagcaccgcggcgcggagacggggcgctgcgacgggacagcgctgccggcgatagcgacggacggagggcggattgtttgagcctttaaacgaacaaaagtaagttattgctatttattgtcagagtcagcggttgaatagtggggttaaatattttggacttaataaaaacaaacgaacaacaa

//