GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 16:32:02, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001293098            2975 bp    mRNA    linear   VRT 13-OCT-2024
DEFINITION  Gallus gallus paired related homeobox 2 (PRRX2), mRNA.
ACCESSION   NM_001293098 XM_415476
VERSION     NM_001293098.3
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2975)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2975)
  AUTHORS   Doufexi,A.E. and Mina,M.
  TITLE     Signaling pathways regulating the expression of Prx1 and Prx2 in
            the chick mandibular mesenchyme
  JOURNAL   Dev Dyn 237 (11), 3115-3127 (2008)
   PUBMED   18942149
  REMARK    GeneRIF: Signaling pathways regulating the expression of Prx1 and
            Prx2 in the chick mandibular mesenchyme.
REFERENCE   3  (bases 1 to 2975)
  AUTHORS   Leussink,B., Brouwer,A., el Khattabi,M., Poelmann,R.E.,
            Gittenberger-de Groot,A.C. and Meijlink,F.
  TITLE     Expression patterns of the paired-related homeobox genes MHox/Prx1
            and S8/Prx2 suggest roles in development of the heart and the
            forebrain
  JOURNAL   Mech Dev 52 (1), 51-64 (1995)
   PUBMED   7577675
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000308.1.
            
            On Nov 9, 2021 this sequence version replaced NM_001293098.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13267659.140009.1,
                                           SRR13267660.20856.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992432
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-487               JAENSK010000308.1  5439168-5439654
            488-672             JAENSK010000308.1  5452397-5452581
            673-851             JAENSK010000308.1  5452690-5452868
            852-2975            JAENSK010000308.1  5453315-5455438
FEATURES             Location/Qualifiers
     source          1..2975
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="17"
                     /map="17"
     gene            1..2975
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /note="paired related homeobox 2"
                     /db_xref="CGNC:66225"
                     /db_xref="GeneID:396314"
     exon            1..487
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /inference="alignment:Splign:2.1.0"
     CDS             244..987
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /codon_start=1
                     /product="paired mesoderm homeobox protein 2"
                     /protein_id="NP_001280027.1"
                     /db_xref="CGNC:66225"
                     /db_xref="GeneID:396314"
                     /translation="
MDSPPAFAMDKPFAPSTVRGPEPPENPQSRKNFSVSHLLDLEEVAAGMNGAPPAGPPPSAGGKAMPEPSGGSSGSEAAPQDGESLSPSRGVAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLANRSASLLKSYSQEAAIEQPMAPRPTALSPEYLSWSSSSPYSTVPSYSSSGTATPTQGVNMANSIASLRLKAKEFSLHQNQVPTVN"
     misc_feature    550..708
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    904..954
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /note="OAR motif; Region: OAR; pfam03826"
                     /db_xref="CDD:461067"
     exon            488..672
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /inference="alignment:Splign:2.1.0"
     exon            673..851
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /inference="alignment:Splign:2.1.0"
     exon            852..2975
                     /gene="PRRX2"
                     /gene_synonym="PMX2; PRX-2; PRX2; S8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcaaagagcaggggaagaaagtttgggctgggagcgtggttttttccccagacgtcagcacaaggcggaacaggggctggggagggagccggactcgcagggcagccgggatttttcttttttttttaattattattattattattattttattattatttggtgggggttggagaagggaaaggggccggggaacggcccggcacctcggggtgggctgcgggccggtgggggtgggagccatggactcgccgccagccttcgccatggacaaaccgttcgcccccagcaccgtgcgcggtccggagccgcccgaaaaccctcagagccggaaaaacttcagcgtgagccatctcctcgacctggaggaggtggcggccgggatgaacggggccccccccgccggccccccaccctccgccggcggtaaggccatgccggagccgtcgggaggcagcagcggcagcgaggcggcaccccaggacggtgagagcctgagcccgagccgtggggtggccaagaggaagaagaagcagaggaggaaccgcaccacattcaacagcagccaactgcaggctctggagagggtctttgagcggacacattaccccgacgccttcgtgcgggaggagctggccaggagggtgaacctcagcgaggccagagtccaggtttggtttcagaaccggagggccaagttccgccgtaacgagagggcgatgttggccaacagatcggcgtcgctcctcaagtcctacagccaggaggctgccatcgagcagcccatggcaccacggcccaccgcgctcagccccgagtacctctcgtggagcagctcctccccatacagcactgtgccatcctacagctccagtgggaccgcgacgcccacccaaggggtgaacatggccaacagcatcgccagcctgcgcctcaaagccaaagagttcagcctgcatcagaaccaggtgccgactgtgaactgaccggggaaaatccccatggcctcatccaggactcgacgtggggatcctgtactgatcggcaccaacccgctgcccgccccacgcactgctcatctgatgtcccagcacctctcctctcctcttccctcttgaaggtagagtcaagtcccagtccgaagtggcacatcgctatagccacatatggagcaaactcggttagaaacttgcttttctgcacacccttataataaaggctatatatacacacacataccccccacgcgctcttcaaggacaaacagacttaccaagcgatcaagaatttgcttccaaacatggaaggatcttggacttttggatttgaccaatttgggtatcttgcctggagagccaaagagttattgggtcttctcctcccacagggacggcacgcagcgctgggatgatcgcgatgctgcacgatgccaattttttgagcccccctttatgctgggccttcacctcctcatgcactgccagccgtggggctcagtgggaccattgcaagcctaccgctgggtcccggtgcccataaactgggggggtggggaaacacatcgctgcacccccatccaggcgccaccgccccatgtctgcgggtttgccagcagttctgcagagccccaggtcattgaaccagcccaaggaaagagaaaattggaaaaagctgtcggtttcagctgagtgggcggctcccagctcttcgtgccaagggcagagcaggcttcgtcttccggaggcacagcatccccagcggccgctctgcagatgggccacagagtgcggggctggaggctccatggggtgttttctgtgtctctgaataaaggaaactgtatttcccaccccagcaagggggcttttggttgcgagatgagcagaaaacttccaacggcggcactgcagctatgtgggatgagccggcgctggggcaataggggatcgactccatggacaaacccgatggagcactctttcctcacccactgcaaggagcagcagccaagcagccaatcaaccctgctcttctaggagggctttgtccggccagcatggtggggccgataacaagtgaatgtagcattggacccaagggtggccacaacagccatagagatcaacacccatcagaacgcgatgccaaggccaaaagtgctcaaaccactttgtaaacccacccaagagcccccacatcctgcccacaggagcttcctctccctttcccaccggggaaagccacatctggtccttggtggccacggtgtcccctgcgtgtgccaggtggggagggcggatctccccatggtgctgcagtgagacctcattgggatcccacaacgctgagcactgccatgcgggcagaggagtccctgcagagcaaacccccaccccaaggaacagcgctgggccgggggggtcccattcccatggaaagcacggggctctttctatttttttaggttatacaagacgaaaccacagggatataaatgtcgctgcctctttgagagcattaatgaaaataaacccatttaatagtttgcagatgccgtttctgtaaacctaaaaaaaaaaaaaaaaaaaaaaaaagcagggaataaatatttcttcactaaatatctatatgtatatatatgtattggaaaccacgcgtccctcagcttcgggcccctccctcgccacgctcttggcagcttaaggcggagcatcgctcagcatcgcaggtgagggatcgcgggctgccgtccgagctctctccctgctctatctgtacatttcagtggttggtaatgagatccacggtggagtttttgatttgatttgatatatatatatattttttttgcatgtctgttttttggaattttttttgttttgttttgtttttgggggtgttttttttttttttgtaaaaacagctcttgtgaaataatggaggaataaatattttactgagtacagtattttac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]