ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-05-14 01:53:53, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001293098 2975 bp mRNA linear VRT 26-JUN-2025 DEFINITION Gallus gallus paired related homeobox 2 (PRRX2), mRNA. ACCESSION NM_001293098 XM_415476 VERSION NM_001293098.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2975) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2975) AUTHORS Doufexi,A.E. and Mina,M. TITLE Signaling pathways regulating the expression of Prx1 and Prx2 in the chick mandibular mesenchyme JOURNAL Dev Dyn 237 (11), 3115-3127 (2008) PUBMED 18942149 REMARK GeneRIF: Signaling pathways regulating the expression of Prx1 and Prx2 in the chick mandibular mesenchyme. REFERENCE 3 (bases 1 to 2975) AUTHORS Leussink,B., Brouwer,A., el Khattabi,M., Poelmann,R.E., Gittenberger-de Groot,A.C. and Meijlink,F. TITLE Expression patterns of the paired-related homeobox genes MHox/Prx1 and S8/Prx2 suggest roles in development of the heart and the forebrain JOURNAL Mech Dev 52 (1), 51-64 (1995) PUBMED 7577675 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000308.1. On Nov 9, 2021 this sequence version replaced NM_001293098.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR13267659.140009.1, SRR13267660.20856.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992432 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-487 JAENSK010000308.1 5439168-5439654 488-672 JAENSK010000308.1 5452397-5452581 673-851 JAENSK010000308.1 5452690-5452868 852-2975 JAENSK010000308.1 5453315-5455438 FEATURES Location/Qualifiers source 1..2975 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="17" /map="17" gene 1..2975 /gene="PRRX2" /gene_synonym="PMX2; PRX-2; PRX2; S8" /note="paired related homeobox 2" /db_xref="CGNC:66225" /db_xref="GeneID:396314" exon 1..487 /gene="PRRX2" /gene_synonym="PMX2; PRX-2; PRX2; S8" /inference="alignment:Splign:2.1.0" CDS 244..987 /gene="PRRX2" /gene_synonym="PMX2; PRX-2; PRX2; S8" /codon_start=1 /product="paired mesoderm homeobox protein 2" /protein_id="NP_001280027.1" /db_xref="CGNC:66225" /db_xref="GeneID:396314" /translation="
MDSPPAFAMDKPFAPSTVRGPEPPENPQSRKNFSVSHLLDLEEVAAGMNGAPPAGPPPSAGGKAMPEPSGGSSGSEAAPQDGESLSPSRGVAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLANRSASLLKSYSQEAAIEQPMAPRPTALSPEYLSWSSSSPYSTVPSYSSSGTATPTQGVNMANSIASLRLKAKEFSLHQNQVPTVN"
misc_feature 550..708
/gene="PRRX2"
/gene_synonym="PMX2; PRX-2; PRX2; S8"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 904..954
/gene="PRRX2"
/gene_synonym="PMX2; PRX-2; PRX2; S8"
/note="OAR motif; Region: OAR; pfam03826"
/db_xref="CDD:461067"
exon 488..672
/gene="PRRX2"
/gene_synonym="PMX2; PRX-2; PRX2; S8"
/inference="alignment:Splign:2.1.0"
exon 673..851
/gene="PRRX2"
/gene_synonym="PMX2; PRX-2; PRX2; S8"
/inference="alignment:Splign:2.1.0"
exon 852..2975
/gene="PRRX2"
/gene_synonym="PMX2; PRX-2; PRX2; S8"
/inference="alignment:Splign:2.1.0"
ORIGIN
agcaaagagcaggggaagaaagtttgggctgggagcgtggttttttccccagacgtcagcacaaggcggaacaggggctggggagggagccggactcgcagggcagccgggatttttcttttttttttaattattattattattattattttattattatttggtgggggttggagaagggaaaggggccggggaacggcccggcacctcggggtgggctgcgggccggtgggggtgggagccatggactcgccgccagccttcgccatggacaaaccgttcgcccccagcaccgtgcgcggtccggagccgcccgaaaaccctcagagccggaaaaacttcagcgtgagccatctcctcgacctggaggaggtggcggccgggatgaacggggccccccccgccggccccccaccctccgccggcggtaaggccatgccggagccgtcgggaggcagcagcggcagcgaggcggcaccccaggacggtgagagcctgagcccgagccgtggggtggccaagaggaagaagaagcagaggaggaaccgcaccacattcaacagcagccaactgcaggctctggagagggtctttgagcggacacattaccccgacgccttcgtgcgggaggagctggccaggagggtgaacctcagcgaggccagagtccaggtttggtttcagaaccggagggccaagttccgccgtaacgagagggcgatgttggccaacagatcggcgtcgctcctcaagtcctacagccaggaggctgccatcgagcagcccatggcaccacggcccaccgcgctcagccccgagtacctctcgtggagcagctcctccccatacagcactgtgccatcctacagctccagtgggaccgcgacgcccacccaaggggtgaacatggccaacagcatcgccagcctgcgcctcaaagccaaagagttcagcctgcatcagaaccaggtgccgactgtgaactgaccggggaaaatccccatggcctcatccaggactcgacgtggggatcctgtactgatcggcaccaacccgctgcccgccccacgcactgctcatctgatgtcccagcacctctcctctcctcttccctcttgaaggtagagtcaagtcccagtccgaagtggcacatcgctatagccacatatggagcaaactcggttagaaacttgcttttctgcacacccttataataaaggctatatatacacacacataccccccacgcgctcttcaaggacaaacagacttaccaagcgatcaagaatttgcttccaaacatggaaggatcttggacttttggatttgaccaatttgggtatcttgcctggagagccaaagagttattgggtcttctcctcccacagggacggcacgcagcgctgggatgatcgcgatgctgcacgatgccaattttttgagcccccctttatgctgggccttcacctcctcatgcactgccagccgtggggctcagtgggaccattgcaagcctaccgctgggtcccggtgcccataaactgggggggtggggaaacacatcgctgcacccccatccaggcgccaccgccccatgtctgcgggtttgccagcagttctgcagagccccaggtcattgaaccagcccaaggaaagagaaaattggaaaaagctgtcggtttcagctgagtgggcggctcccagctcttcgtgccaagggcagagcaggcttcgtcttccggaggcacagcatccccagcggccgctctgcagatgggccacagagtgcggggctggaggctccatggggtgttttctgtgtctctgaataaaggaaactgtatttcccaccccagcaagggggcttttggttgcgagatgagcagaaaacttccaacggcggcactgcagctatgtgggatgagccggcgctggggcaataggggatcgactccatggacaaacccgatggagcactctttcctcacccactgcaaggagcagcagccaagcagccaatcaaccctgctcttctaggagggctttgtccggccagcatggtggggccgataacaagtgaatgtagcattggacccaagggtggccacaacagccatagagatcaacacccatcagaacgcgatgccaaggccaaaagtgctcaaaccactttgtaaacccacccaagagcccccacatcctgcccacaggagcttcctctccctttcccaccggggaaagccacatctggtccttggtggccacggtgtcccctgcgtgtgccaggtggggagggcggatctccccatggtgctgcagtgagacctcattgggatcccacaacgctgagcactgccatgcgggcagaggagtccctgcagagcaaacccccaccccaaggaacagcgctgggccgggggggtcccattcccatggaaagcacggggctctttctatttttttaggttatacaagacgaaaccacagggatataaatgtcgctgcctctttgagagcattaatgaaaataaacccatttaatagtttgcagatgccgtttctgtaaacctaaaaaaaaaaaaaaaaaaaaaaaaagcagggaataaatatttcttcactaaatatctatatgtatatatatgtattggaaaccacgcgtccctcagcttcgggcccctccctcgccacgctcttggcagcttaaggcggagcatcgctcagcatcgcaggtgagggatcgcgggctgccgtccgagctctctccctgctctatctgtacatttcagtggttggtaatgagatccacggtggagtttttgatttgatttgatatatatatatattttttttgcatgtctgttttttggaattttttttgttttgttttgtttttgggggtgttttttttttttttgtaaaaacagctcttgtgaaataatggaggaataaatattttactgagtacagtattttac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]