GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 14:10:26, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001277768             843 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA.
ACCESSION   NM_001277768
VERSION     NM_001277768.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 843)
  AUTHORS   Collins MM, Baumholtz AI, Simard A, Gregory M, Cyr DG and Ryan AK.
  TITLE     Claudin-10 is required for relay of left-right patterning cues from
            Hensen's node to the lateral plate mesoderm
  JOURNAL   Dev Biol 401 (2), 236-248 (2015)
   PUBMED   25744724
  REMARK    GeneRIF: The data demonstrate a novel role for Claudin-10 during
            the transmission of laterality information from Hensen's node to
            both the left and right sides of the embryo. [claudin-10]
REFERENCE   3  (bases 1 to 843)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 843)
  AUTHORS   Seo HW, Rengaraj D, Choi JW, Ahn SE, Song YS, Song G and Han JY.
  TITLE     Claudin 10 is a glandular epithelial marker in the chicken model as
            human epithelial ovarian cancer
  JOURNAL   Int J Gynecol Cancer 20 (9), 1465-1473 (2010)
   PUBMED   21370593
  REMARK    GeneRIF: New insight into using the chicken as a suitable animal
            model for investigating the effect and function of CLDN in human
            ovarian cancer.
REFERENCE   5  (bases 1 to 843)
  AUTHORS   Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
            Burnside J, Aggrey SE, Simon J and Cogburn LA.
  TITLE     Chicken genomics resource: sequencing and annotation of 35,407 ESTs
            from single and multiple tissue cDNA libraries and CAP3 assembly of
            a chicken gene index
  JOURNAL   Physiol Genomics 25 (3), 514-524 (2006)
   PUBMED   16554550
REFERENCE   6  (bases 1 to 843)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BU380770.1, BU121320.1, BX930125.1 and JAENSK010000025.1.
            
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice junction at the 5' end of an internal exon compared to
            variant 1. The resulting isoform (2) has the same N- and C-termini
            but is shorter compared to isoform 1.
            
            ##Evidence-Data-START##
            RNAseq introns :: partial sample support SAMEA103992290,
                              SAMEA103992323 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-230               BU380770.1         1-230
            231-342             BU121320.1         242-353
            343-835             BX930125.1         457-949
            836-843             JAENSK010000025.1  18150826-18150833   c
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="1"
                     /map="1"
                     /breed="Leghorn"
     gene            1..843
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="claudin 10"
                     /db_xref="CGNC:13756"
                     /db_xref="GeneID:418790"
     exon            1..230
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     CDS             11..577
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2"
                     /codon_start=1
                     /product="claudin-10 isoform 2 precursor"
                     /protein_id="NP_001264697.1"
                     /db_xref="CGNC:13756"
                     /db_xref="GeneID:418790"
                     /translation="
MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV"
     sig_peptide     11..79
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    29..427
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            231..272
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            273..354
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            355..462
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            463..843
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gtcgggcccgatggcgagcacgtcggcggagatcgtcgccttcctgctgaccatctccggctgggtgctggtgtcgtccacgctgcccaccgactactggaaggtgtcttccatcgacggcacggtcatcaccaccgccaccttctgggccaacctctggaagacctgcgtgaccgactccaccggcgtctccaactgcaaggacttcccgtccatgctggctctcgacgcaagaatagcttgtttagctggactgattttcatactgtgtgggctgtgctccatgactggttgttccctgtatgcacacaggattacgtctgagttctttgatccttcttttgttgcacaaaagtatgaattaggagcagctttattcattggatgggctggagcttcactctgcatcattggtggcagtatattctgcttctcaatagctgagaacagtaaatctccaaggagagcgtatgcatataatggagccgcatctgtgatgtcgtctcgtacaaagattcacaacagtgtcccagacaaaacctcaccaaagcactttgacaagaacgcttacgtttaagtgtacttttctaagatctgaagccagttttaaaaatgagtttgtatgtttcattcagggtgatttccccccccacctccccacaacacaatggaattaccactaagaatgaatttgtaaggtgttatcttgcagctttttccacgttgatgtaaattttattatattttaagattgatgtttgtattataaagtttatacctgcaaatcatgcattgatgctgctttctaaaaaagaaaaataaagagggtatttacagatgcag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]