2024-07-01 22:19:01, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001277723 2562 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus four and a half LIM domains 5 (FHL5), mRNA. ACCESSION NM_001277723 XM_419829 VERSION NM_001277723.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2562) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 2562) AUTHORS Oshiumi H, Shida K, Goitsuka R, Kimura Y, Katoh J, Ohba S, Tamaki Y, Hattori T, Yamada N, Inoue N, Matsumoto M, Mizuno S and Seya T. TITLE Regulator of complement activation (RCA) locus in chicken: identification of chicken RCA gene cluster and functional RCA proteins JOURNAL J Immunol 175 (3), 1724-1734 (2005) PUBMED 16034113 REMARK GeneRIF: Chicken regulator of complement genes CREM (cAMP-responsive element modulator), CREG, and CRES are located in a single locus; expression of CREM on hamster CHO cells blocks chicken serum-mediated cytotoxicity COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000065.1. On Sep 23, 2021 this sequence version replaced NM_001277723.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: ERR2365562.92492.1, BX929623.2 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992531 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-237 JAENSK010000065.1 9789715-9789951 c 238-269 JAENSK010000065.1 9789444-9789475 c 270-440 JAENSK010000065.1 9772822-9772992 c 441-615 JAENSK010000065.1 9770326-9770500 c 616-785 JAENSK010000065.1 9768380-9768549 c 786-972 JAENSK010000065.1 9764887-9765073 c 973-2562 JAENSK010000065.1 9762092-9763681 c FEATURES Location/Qualifiers source 1..2562 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="3" /map="3" gene 1..2562 /gene="FHL5" /note="four and a half LIM domains 5" /db_xref="CGNC:11609" /db_xref="GeneID:421803" exon 1..237 /gene="FHL5" /inference="alignment:Splign:2.1.0" misc_feature 195..197 /gene="FHL5" /note="upstream in-frame stop codon" exon 238..269 /gene="FHL5" /inference="alignment:Splign:2.1.0" exon 270..440 /gene="FHL5" /inference="alignment:Splign:2.1.0" CDS 282..1121 /gene="FHL5" /note="activator of cAMP-responsive element modulator (CREM) in testis" /codon_start=1 /product="four and a half LIM domains protein 5" /protein_id="NP_001264652.1" /db_xref="CGNC:11609" /db_xref="GeneID:421803" /translation="
MTSNHSDCHYCLQSLRGRKYALKEENAYCVRCYDSLFANSCEECKEPIECDSKDLAYKGRHWHERCFKCTKCSRSLVEKPFAAKDELLLCTECYSNEYSSKCFHCQKTIMPGSRKMEFKGSSWHESCFVCQYCQQPLGTKPLITKDNENYCVPCFEKQFAHRCYSCKKVITSGGVAYHDQPWHKECFVCAGCKTQLSGQRFVSKDEYPYCVDCFSKFYAKKCTACKKPITALGGAKFVSFEECQWHEECFNCARCSVSLVGQGFLTKQDAVLCHECGSS"
misc_feature 390..566 /gene="FHL5" /note="The first LIM domain of Four and a half LIM domains protein (FHL); Region: LIM1_FHL; cd09343" /db_xref="CDD:188729" misc_feature order(402..404,411..413,468..470,477..479,486..488, 495..497,549..551,558..560) /gene="FHL5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188729" misc_feature 585..746 /gene="FHL5" /note="The second LIM domain of Four and a half LIM domains protein 5 (FHL5); Region: LIM2_FHL5; cd09428" /db_xref="CDD:188812" misc_feature order(585..587,594..596,651..653,660..662,669..671, 678..680,732..734,741..743) /gene="FHL5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188812" misc_feature 768..923 /gene="FHL5" /note="The third LIM domain of Four and a half LIM domains protein (FHL); Region: LIM3_FHL; cd09346" /db_xref="CDD:188732" misc_feature order(768..770,777..779,828..830,837..839,846..848, 855..857,909..911,918..920) /gene="FHL5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188732" misc_feature 945..1112 /gene="FHL5" /note="The fourth LIM domain of Four and a half LIM domains protein (FHL); Region: LIM4_FHL; cd09347" /db_xref="CDD:188733" misc_feature order(945..947,954..956,1017..1019,1026..1028,1035..1037, 1044..1046,1098..1100,1107..1109) /gene="FHL5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188733" exon 441..615 /gene="FHL5" /inference="alignment:Splign:2.1.0" exon 616..785 /gene="FHL5" /inference="alignment:Splign:2.1.0" exon 786..972 /gene="FHL5" /inference="alignment:Splign:2.1.0" exon 973..2562 /gene="FHL5" /inference="alignment:Splign:2.1.0" ORIGIN
gtatgcaacagtcataggttagtaatcacgactttttcccttctctgaattacaagcccaagtgaggtcttttggattccttctttgtgggccacagcgtagctggggacaagtggtgatccatcattttattttttctttctactaaagagtttcagggttttgagtttttagcagaagtacctttttctttttgacaactgtctgaaatatgttcctttgagatcctcctacacgaagttaccaggagaagcagcttggaactaaataactccaccagaatgaccagcaatcactcagactgccattactgcctgcagtctctccgtggaaggaagtatgcattaaaggaagagaatgcttattgtgttagatgctatgacagcctatttgccaactcctgtgaggagtgcaaggaacctattgaatgtgattccaaggatctggcttacaaaggccgccactggcacgagaggtgtttcaagtgcaccaaatgcagccgttctctggtagagaaaccattcgctgccaaggatgagctcttgctctgtactgaatgttactccaatgagtattcatcaaagtgtttccactgccagaagaccatcatgcctggttcccgtaaaatggaatttaagggcagttcctggcatgaatcctgttttgtttgtcagtattgccagcaaccactgggaacaaaaccactgatcaccaaagacaatgagaattactgcgtaccctgttttgagaaacaatttgctcatcgttgctactcttgcaaaaaggtaataacttctgggggagtggcctaccacgaccagccttggcataaagagtgctttgtgtgtgctggatgtaaaactcagctgtctgggcaaaggtttgtttccaaagatgagtatccatactgtgtagattgtttcagcaagttttatgctaagaagtgtactgcttgcaagaaacctattacagctcttggaggtgccaaatttgtctcatttgaagagtgtcagtggcatgaggaatgttttaactgtgcaagatgctcagtctcactggtgggccaaggattcctcaccaagcaggatgcagtcctttgccatgaatgtggttcttcgtagttctgtggagagctataaagatgaattattctcactatataaccatgtactttgttactctgcagtaagaaaatcatttaaaaggtgtatcacttatttagcaattcaagtaactttccaacagcagtttaattccatcacagttgtgaacttcttgttataaaaataaataaataaacagccacatactgcctcagaaaacagtgcagaaaagattagtatatattttaaatataactgcagtatgtttctccttgtaacacactgcactctgctgttagaaactttaactttcatttcccacgaaccaaggaggtgtatagaaagtctatgtgacatatatctagttatgaggcattagcattgcaagtgaggaggaggtacgtgtacacaaagagacaccaagtcagggaaatccattccagggccagagaaagggataaaagatcctttccctctctttattgatattgttgagagtgctcatcagaaaaatagaatttcccataaatttagtcatccaaaaaactgaacgataggtcctttcccaaaactggtcaattgcattttatttttcaggcataaatgttttagaacatgaacaaacccttttttaattttaatttttatttttaaatctactgtaagaggtacagattgcccaaggttggatagtggtaatgtatagtttccaatatctaatatgatttaaaactgtctccattatcttcactagaccttcaagtgcactcttaaaatatagtttctcttatttgaggcaagagccaacacacagctgtccctttaaactacatttttcctcccttcaacactcatttgccagcagtcaaaatactgataatggctttaccatttctgcactgcagtctttgattcacagtcaactccttttcttgtaaacgtccacttgtctgtagcaggctatcagctgctcagagccaatacctagttcattctgccacgtgccaacatgcatgtgccaatattatgtcaagaatttgtaatgttgccatatcaaggtaggcagtgctcacatgtagtaccaggtagtagtttctctttccttagctcatgctatatacacactatatgttacaatggcctgactcattctgcagtatctctaccaggccatggtgtaggataccgcggttctatgcctattagatgttgttttgctcctcatctcacgtgtctgaaaattgttctcctttagactctgatgttgaaaacttacagttatttgtctgacttgagagcactttattcatactgaattatgtagatgctgcttcaagtagaaaaaggagaaaaaaagaacttgtaagcatagctaagccagagctatatggcagtggcataaaatcaacaagtacatagcaatctgtttcccaatcaataaagtattaatcttctgcta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]