GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-19 16:03:48, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001277622            1509 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus claudin 2 (CLDN2), mRNA.
ACCESSION   NM_001277622 XM_420271
VERSION     NM_001277622.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1509)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1509)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1509)
  AUTHORS   Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H.
  TITLE     Analysis of the RPE transcriptome reveals dynamic changes during
            the development of the outer blood-retinal barrier
  JOURNAL   Mol Vis 13, 1259-1273 (2007)
   PUBMED   17679949
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1509)
  AUTHORS   Min W, Lillehoj HS, Ashwell CM, van Tassell CP, Dalloul RA,
            Matukumalli LK, Han JY and Lillehoj EP.
  TITLE     Expressed sequence tag analysis of Eimeria-stimulated intestinal
            intraepithelial lymphocytes in chickens
  JOURNAL   Mol Biotechnol 30 (2), 143-150 (2005)
   PUBMED   15920284
REFERENCE   5  (bases 1 to 1509)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BX934932.2, BU303705.1 and CD737584.1.
            
            On Apr 13, 2013 this sequence version replaced XM_420271.3.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX934932.2, BU123232.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1068              BX934932.2         1-1068
            1069-1448           BU303705.1         279-658
            1449-1509           CD737584.1         324-384
FEATURES             Location/Qualifiers
     source          1..1509
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /map="4"
                     /breed="Leghorn"
     gene            1..1509
                     /gene="CLDN2"
                     /note="claudin 2"
                     /db_xref="CGNC:5527"
                     /db_xref="GeneID:422292"
     exon            1..186
                     /gene="CLDN2"
                     /inference="alignment:Splign:2.1.0"
     exon            187..1493
                     /gene="CLDN2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    298..300
                     /gene="CLDN2"
                     /note="upstream in-frame stop codon"
     CDS             340..1023
                     /gene="CLDN2"
                     /codon_start=1
                     /product="claudin-2"
                     /protein_id="NP_001264551.1"
                     /db_xref="CGNC:5527"
                     /db_xref="GeneID:422292"
                     /translation="
MVSMGLQLVGYIVAFLGYIGTLTTTLLPNWKISSYIGSSIVTAVSFTKGLWMECATYSTGITQCDIYSSLLNLPPDIQAAQALMVSSCAVSSLACLIAVVGMRCTVFNQGSPAKDRVAVAGGVVFILGGLLCFIPLVWNIHVVLRDFHNPLLPDSTKFEMGEALYLGIISSLLTLIGGFILCASCPPRDPSGPYSPRLLASRSPQPSIKQMQKPKSEFSSYNLTGYV"
     misc_feature    349..882
                     /gene="CLDN2"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
ctcaatccttcctgacaccgaaagggtttaattctgatctgcaataagcctccaggctgagatttgtggatggattttgcaaagctgacgtgaaccattcgcagtccctgatccctggccctgacgagcctcttcctgtaggactgcagctgccctcggtcccgcaccacatctccagccatctctgtaacctctcctccccccggctcaccccacgtgcctgtgccctcacaaaaccagcacccacagcagcagggtgaagcttcagcacagcgagaggagccgctagcagggccatgaaaaggtaaacgtgcgggagaggtgacacccggcccaaccatggtctctatgggactccagctggtgggctacatcgtggccttcctgggctacatcggcacgctgacgaccacgctgctgcccaactggaagatcagctcctacattggttcaagcatcgtgacagccgtgagcttcaccaaggggctatggatggagtgtgctacgtatagcacgggcatcactcagtgcgacatctacagctccctgctcaacctgcctcccgacatccaagcagcccaggccctgatggtgagctcctgtgctgtctcctcccttgcttgccttatagccgtggtgggcatgaggtgcaccgtcttcaatcagggctcaccagccaaggaccgagtggcagtggcgggtggggtggtcttcatcctcggggggctgctttgcttcatcccactggtatggaacatccacgtggtgctgcgagatttccacaaccccttgctccctgacagcaccaaatttgagatgggggaggctctatacctgggcatcatctcctccctgctcaccctcattggaggcttcatcctctgtgcctcctgccctccccgtgacccatcgggcccctactcgccccggctgctggcaagcaggagtcctcagccctccatcaaacagatgcagaagcccaagagtgagttcagctcttacaacctgacgggatacgtgtagcagcagcagggcacctggccagcactgttcccagctcccaaaaaacctgggctggcaccgagggcacacagtaagaggagaagacgcagcggtgtctcccgcgctcgtatctcttgcttggggatcttgacatatgactgctcagaaatcccagctgatggcaaaggaccctgaatccagcttctgttactattttggtgccatcagcctgctggaactgcccctgcaagccagctggaagcgcacccatagcccctgcaaggcagcctcgtcacagccatactctagcctgtagcccatggcccagcaaggacagtgaaattgtgccgctggggctcacctgcacacctgaggctctggagacactgggggggattagggcacccacaggggcccagaatcttcgggggagagcggggggatggagtactgattgcaagctgatatcacaataaatctatgtttctagaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]