2025-10-19 16:03:48, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001277622 1509 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus claudin 2 (CLDN2), mRNA. ACCESSION NM_001277622 XM_420271 VERSION NM_001277622.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1509) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1509) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1509) AUTHORS Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H. TITLE Analysis of the RPE transcriptome reveals dynamic changes during the development of the outer blood-retinal barrier JOURNAL Mol Vis 13, 1259-1273 (2007) PUBMED 17679949 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1509) AUTHORS Min W, Lillehoj HS, Ashwell CM, van Tassell CP, Dalloul RA, Matukumalli LK, Han JY and Lillehoj EP. TITLE Expressed sequence tag analysis of Eimeria-stimulated intestinal intraepithelial lymphocytes in chickens JOURNAL Mol Biotechnol 30 (2), 143-150 (2005) PUBMED 15920284 REFERENCE 5 (bases 1 to 1509) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BX934932.2, BU303705.1 and CD737584.1. On Apr 13, 2013 this sequence version replaced XM_420271.3. ##Evidence-Data-START## Transcript exon combination :: BX934932.2, BU123232.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1068 BX934932.2 1-1068 1069-1448 BU303705.1 279-658 1449-1509 CD737584.1 324-384 FEATURES Location/Qualifiers source 1..1509 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="4" /map="4" /breed="Leghorn" gene 1..1509 /gene="CLDN2" /note="claudin 2" /db_xref="CGNC:5527" /db_xref="GeneID:422292" exon 1..186 /gene="CLDN2" /inference="alignment:Splign:2.1.0" exon 187..1493 /gene="CLDN2" /inference="alignment:Splign:2.1.0" misc_feature 298..300 /gene="CLDN2" /note="upstream in-frame stop codon" CDS 340..1023 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="NP_001264551.1" /db_xref="CGNC:5527" /db_xref="GeneID:422292" /translation="
MVSMGLQLVGYIVAFLGYIGTLTTTLLPNWKISSYIGSSIVTAVSFTKGLWMECATYSTGITQCDIYSSLLNLPPDIQAAQALMVSSCAVSSLACLIAVVGMRCTVFNQGSPAKDRVAVAGGVVFILGGLLCFIPLVWNIHVVLRDFHNPLLPDSTKFEMGEALYLGIISSLLTLIGGFILCASCPPRDPSGPYSPRLLASRSPQPSIKQMQKPKSEFSSYNLTGYV"
misc_feature 349..882 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ctcaatccttcctgacaccgaaagggtttaattctgatctgcaataagcctccaggctgagatttgtggatggattttgcaaagctgacgtgaaccattcgcagtccctgatccctggccctgacgagcctcttcctgtaggactgcagctgccctcggtcccgcaccacatctccagccatctctgtaacctctcctccccccggctcaccccacgtgcctgtgccctcacaaaaccagcacccacagcagcagggtgaagcttcagcacagcgagaggagccgctagcagggccatgaaaaggtaaacgtgcgggagaggtgacacccggcccaaccatggtctctatgggactccagctggtgggctacatcgtggccttcctgggctacatcggcacgctgacgaccacgctgctgcccaactggaagatcagctcctacattggttcaagcatcgtgacagccgtgagcttcaccaaggggctatggatggagtgtgctacgtatagcacgggcatcactcagtgcgacatctacagctccctgctcaacctgcctcccgacatccaagcagcccaggccctgatggtgagctcctgtgctgtctcctcccttgcttgccttatagccgtggtgggcatgaggtgcaccgtcttcaatcagggctcaccagccaaggaccgagtggcagtggcgggtggggtggtcttcatcctcggggggctgctttgcttcatcccactggtatggaacatccacgtggtgctgcgagatttccacaaccccttgctccctgacagcaccaaatttgagatgggggaggctctatacctgggcatcatctcctccctgctcaccctcattggaggcttcatcctctgtgcctcctgccctccccgtgacccatcgggcccctactcgccccggctgctggcaagcaggagtcctcagccctccatcaaacagatgcagaagcccaagagtgagttcagctcttacaacctgacgggatacgtgtagcagcagcagggcacctggccagcactgttcccagctcccaaaaaacctgggctggcaccgagggcacacagtaagaggagaagacgcagcggtgtctcccgcgctcgtatctcttgcttggggatcttgacatatgactgctcagaaatcccagctgatggcaaaggaccctgaatccagcttctgttactattttggtgccatcagcctgctggaactgcccctgcaagccagctggaagcgcacccatagcccctgcaaggcagcctcgtcacagccatactctagcctgtagcccatggcccagcaaggacagtgaaattgtgccgctggggctcacctgcacacctgaggctctggagacactgggggggattagggcacccacaggggcccagaatcttcgggggagagcggggggatggagtactgattgcaagctgatatcacaataaatctatgtttctagaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]