2024-07-01 22:23:14, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001277553 1178 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus GRB2 related adaptor protein like (GRAPL), mRNA. ACCESSION NM_001277553 XM_003642116 XM_414827 VERSION NM_001277553.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1178) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1178) AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, Korn B and Buerstedde JM. TITLE A large database of chicken bursal ESTs as a resource for the analysis of vertebrate gene function JOURNAL Genome Res 10 (12), 2062-2069 (2000) PUBMED 11116100 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000257.1. On Sep 23, 2021 this sequence version replaced NM_001277553.1. ##Evidence-Data-START## Transcript exon combination :: BX931837.2, HAEK01072420.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA103992290, SAMEA103992323 [ECO:0006172] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-180 JAENSK010000257.1 5175338-5175517 c 181-278 JAENSK010000257.1 5174273-5174370 c 279-401 JAENSK010000257.1 5173189-5173311 c 402-570 JAENSK010000257.1 5172300-5172468 c 571-1178 JAENSK010000257.1 5171474-5172081 c FEATURES Location/Qualifiers source 1..1178 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="14" /map="14" gene 1..1178 /gene="GRAPL" /gene_synonym="GRAP" /note="GRB2 related adaptor protein like" /db_xref="CGNC:50277" /db_xref="GeneID:416523" exon 1..180 /gene="GRAPL" /gene_synonym="GRAP" /inference="alignment:Splign:2.1.0" CDS 103..756 /gene="GRAPL" /gene_synonym="GRAP" /codon_start=1 /product="GRB2-related adapter protein" /protein_id="NP_001264482.2" /db_xref="CGNC:50277" /db_xref="GeneID:416523" /translation="
MESVALYNFQTTEKDELPFQKGDTLKILNMEDDQNWYKAELYGCEGFVPKNYIKVKPHPWYAGRISRHVAEELLLKRRYVGAFLIRESESAPGEFSISVNYGQHVQHFKVLRERNGKYFLWEEKFNSLNELVDFYRTTTIAKKQQIFLRDDEQSPEVKRPKFVQAQFDFSAHDSSQLPFYRGDIIEVLDCPDPNWWQGKIYGRIGFFPRNYVHPIRK"
misc_feature 106..267 /gene="GRAPL" /gene_synonym="GRAP" /note="N-terminal Src homology 3 domain of GRB2-related adaptor protein; Region: SH3_GRAP_N; cd11948" /db_xref="CDD:212881" misc_feature order(118..129,136..141,148..150,205..210,247..258) /gene="GRAPL" /gene_synonym="GRAP" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212881" misc_feature 268..552 /gene="GRAPL" /gene_synonym="GRAP" /note="Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins; Region: SH2_Grb2_like; cd09941" /db_xref="CDD:199828" misc_feature order(301..303,358..360,364..366,388..390,421..423, 427..429) /gene="GRAPL" /gene_synonym="GRAP" /note="phosphotyrosine binding pocket [polypeptide binding]; other site" /db_xref="CDD:199828" misc_feature 586..744 /gene="GRAPL" /gene_synonym="GRAP" /note="C-terminal Src homology 3 domain of GRB2-related adaptor protein; Region: SH3_GRAP_C; cd11951" /db_xref="CDD:212884" misc_feature order(601..603,607..609,616..621,628..630,682..687, 718..720,724..726,730..735) /gene="GRAPL" /gene_synonym="GRAP" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212884" exon 181..278 /gene="GRAPL" /gene_synonym="GRAP" /inference="alignment:Splign:2.1.0" exon 279..401 /gene="GRAPL" /gene_synonym="GRAP" /inference="alignment:Splign:2.1.0" exon 402..570 /gene="GRAPL" /gene_synonym="GRAP" /inference="alignment:Splign:2.1.0" exon 571..1178 /gene="GRAPL" /gene_synonym="GRAP" /inference="alignment:Splign:2.1.0" ORIGIN
gacatcagcgcggcttcctgcctgccggcagcacccgccccgggccccacagccccgtgccgtggggcagcgagccccagggccccgctcgtgccctgcagcatggagtcggtggctctgtacaacttccagacaacggagaaggatgagctgcccttccagaaaggggacaccttgaagatcctcaacatggaagatgaccagaactggtacaaggctgagctgtatggctgcgagggctttgtccccaaaaactacatcaaagtcaaaccccacccgtggtatgcagggaggatctcccggcacgtggcagaggagctgctcctcaagcgcagatatgtgggagccttcctgatccgtgagagcgagagcgcgccgggggagttctccatctccgtcaactacgggcagcacgtccagcacttcaaggtgctccgtgagcgcaatggcaaatatttcctctgggaggagaagttcaactccctcaatgagctggtggacttctacaggaccaccaccatcgccaagaagcagcagatcttccttcgggatgacgagcagagcccagaggtgaaaagacccaaattcgtgcaagcccagttcgacttctctgcccatgacagctcccagctgcccttctaccgcggggacatcatcgaggtgctggactgccccgaccccaactggtggcagggaaagatctatggacgcattggcttcttcccccgcaattatgtccaccccatccgcaagtgagccgccgctgccgccccgcttcgcgcatcccccatccccacgctgtccccatgggctgcagatcccggcagtgccatctgtggatgctgtgctggaggcagatgctgccccgctcccagcaccaacaaatacccacgtgaagaagcagagggctgcgtgacattgaggggtatccaaacttttgtggagtcacgatgggtggcagctcctggccaggacctctccagccccagctccaggaaggctgcagtcagctgggacgtggctgggctcagggatgctgcagagcagttctggggcatggggtgctggaagggctgctcaggaggaattcggtcctgctggtgccatttgtagctgcaaattgtggctttttcattttttatttttatctagagttagtaaagtgtgttgggattaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]