2025-09-16 23:53:34, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001277282 938 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus homeobox C9 (HOXC9), mRNA. ACCESSION NM_001277282 XM_423451 VERSION NM_001277282.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 938) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 938) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 938) AUTHORS Izpisua-Belmonte JC, Tickle C, Dolle P, Wolpert L and Duboule D. TITLE Expression of the homeobox Hox-4 genes and the specification of position in chick wing development JOURNAL Nature 350 (6319), 585-589 (1991) PUBMED 1673231 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000489.1. On Dec 15, 2021 this sequence version replaced NM_001277282.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BX950823.1, HAEL01007746.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992323, SAMEA103992415 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-580 JAENSK010000489.1 20401-20980 c 581-938 JAENSK010000489.1 17993-18350 c FEATURES Location/Qualifiers source 1..938 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="34" /map="34" gene 1..938 /gene="HOXC9" /note="homeobox C9" /db_xref="CGNC:8844" /db_xref="GeneID:425723" exon 1..580 /gene="HOXC9" /inference="alignment:Splign:2.1.0" misc_feature 7..9 /gene="HOXC9" /note="upstream in-frame stop codon" CDS 37..825 /gene="HOXC9" /note="chox-4.4; homeobox protein Hox-4.4; homeo box C9" /codon_start=1 /product="homeobox protein HoxC9" /protein_id="NP_001264211.1" /db_xref="CGNC:8844" /db_xref="GeneID:425723" /translation="
MSASGPISNYYVDSLISHENEELLASRFPTTASHPAAARPSGLVPDCADFPSCSFAPKPAVFTTSWAPVHSQSSVGYHHPYGPQAPVGAEPRYMRTWLEPLAGAVSFPAFAPGAARPYGLKPDAFAGRRAECGPADGRGFADYMYAAPGELRDRAAQTIPSPESEAIASSKHKEEKHELDPNNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQP"
misc_feature 37..579 /gene="HOXC9" /note="Hox9 activation region; Region: Hox9_act; pfam04617" /db_xref="CDD:461369" misc_feature 619..765 /gene="HOXC9" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 581..938 /gene="HOXC9" /inference="alignment:Splign:2.1.0" ORIGIN
atacaataatcttatgaatgtaaaagagggggaaccatgtcggcttctggccccataagcaactactatgtagactccttgataagccacgaaaacgaagagctcttggcctccaggttccccaccactgcctcccacccggctgctgccagaccttcaggattagtcccggactgtgccgactttccttcgtgcagtttcgcccccaagccggccgtttttacaacctcctgggctcccgtccattcccagtcgtccgtgggctaccaccacccgtacggcccccaggctcccgtgggggccgagcccaggtacatgcggacttggctcgagcccctcgccggggccgtctcgttcccggccttcgctcccggtgccgcccgcccctacggcctcaaacccgacgcctttgccgggagacgcgcggagtgcggccccgcggacgggcgcggcttcgcggactacatgtacgcggctcccggggagctgagagacagagcagcgcagacaattccttccccggagtccgaagccatcgcttccagcaaacacaaagaagaaaagcacgaattagaccctaacaatcccgtcgcgaattggattcatgcgcgttccacgaggaagaaaagatgtccgtacacaaagtatcagaccctggaactggaaaaagagtttttattcaatatgtacctcacacgggaccggaggtacgaagtagcccgagtcctaaacctcactgaacgccaagtcaaaatctggtttcagaacaggcgaatgaaaatgaagaaaatgaataaagagaaaaccgataaggaacagccatgaaaagtcgtgcgaggagaaacgagggcggaaaaaggaaaaaaaaaagaaaaaagaaaaaaaaaagaggaaaaaaaaaaacccaacaaaaagaaggcaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]