2024-07-01 22:15:53, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001257333 742 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus ribosomal protein L9 (RPL9), mRNA. ACCESSION NM_001257333 XM_003641246 VERSION NM_001257333.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 742) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 742) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 742) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000074.1. On Sep 23, 2021 this sequence version replaced NM_001257333.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data from different strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: CF251699.1, BU144270.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-27 JAENSK010000074.1 21839287-21839313 28-74 JAENSK010000074.1 21839726-21839772 75-190 JAENSK010000074.1 21839855-21839970 191-286 JAENSK010000074.1 21840843-21840938 287-419 JAENSK010000074.1 21841248-21841380 420-500 JAENSK010000074.1 21843358-21843438 501-619 JAENSK010000074.1 21843729-21843847 620-742 JAENSK010000074.1 21845018-21845140 FEATURES Location/Qualifiers source 1..742 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="4" /map="4" gene 1..742 /gene="RPL9" /note="ribosomal protein L9" /db_xref="CGNC:52467" /db_xref="GeneID:425468" exon 1..27 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 28..74 /gene="RPL9" /inference="alignment:Splign:2.1.0" CDS 29..607 /gene="RPL9" /codon_start=1 /product="large ribosomal subunit protein uL6" /protein_id="NP_001244262.1" /db_xref="CGNC:52467" /db_xref="GeneID:425468" /translation="
MKTILSNQTVDIPEQVSVSLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKRRKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQDNGSLVEIRNFLGEKYIRRVRMRPGVSCAVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
misc_feature 29..601 /gene="RPL9" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" exon 75..190 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 191..286 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 287..419 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 420..500 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 501..619 /gene="RPL9" /inference="alignment:Splign:2.1.0" exon 620..742 /gene="RPL9" /inference="alignment:Splign:2.1.0" ORIGIN
gcccctttcggcgctgcctgctgccagaatgaagaccatcctcagcaaccagaccgtggacatccctgagcaagtcagcgtgtccctgaagggccgcacggtcatcgtgaagggcccccggggaaccctgcggagagacttcaaccacatcaacgtggagctgtccctcttggggaagaagcgcaggaagctgcgtgttgacaagtggtggggtaacagaaaggagctggccacggtccgcacaatttgcagccatgtacagaacatgataaagggcgttacgctgggcttccgttataagatgaggtcggtgtacgctcacttcccaatcaatgtagtcatacaggataacggctcacttgtggaaatccgaaactttttgggagagaagtacattcgcagggtgcgcatgaggccaggtgtttcctgtgctgtttctcaagcccagaaagatgagctgatccttgaagggaatgacattgaattggtctccaattcagctgccttgatccagcaagccactacagtcaagaataaggatatcaggaaattcttggacggtatctacgtctccgagaaaggaacagtacagcaggcagatgagtagaactcttactagttgtctgggtcctgaaaaacaaaacaaaaaatgagacggcatatcagcacgtaatggattgggacatctgatgcaaaaaactgaacaagatcagaggtttaataaaataaaacatatttcata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]