2024-07-01 22:29:01, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001244738 1673 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus E2F transcription factor 6 (E2F6), transcript variant 1, mRNA. ACCESSION NM_001244738 VERSION NM_001244738.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1673) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1673) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1673) AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj HS, Cho BW and Han JY. TITLE Analysis of chicken embryonic gonad expressed sequenced tags JOURNAL Anim Genet 37 (1), 85-86 (2006) PUBMED 16441308 REFERENCE 4 (bases 1 to 1673) AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg J. TITLE ESTs from brain and testis of White Leghorn and red junglefowl: annotation, bioinformatic classification of unknown transcripts and analysis of expression levels JOURNAL Cytogenet Genome Res 111 (1), 79-87 (2005) PUBMED 16093725 REFERENCE 5 (bases 1 to 1673) AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci P, Hayashizaki Y and Buerstedde JM. TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis JOURNAL Genome Biol 6 (1), R6 (2005) PUBMED 15642098 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000066.1. On Sep 23, 2021 this sequence version replaced NM_001244738.1. Transcript Variant: This variant (1) represents the longer transcript and is protein-coding. Sequence Note: This RefSeq record was created from transcripts from multiple strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: HAEK01013050.1, CV860592.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA103992290, SAMEA103992323 [ECO:0006172] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-289 JAENSK010000066.1 2015269-2015557 c 290-338 JAENSK010000066.1 2010835-2010883 c 339-555 JAENSK010000066.1 2009873-2010089 c 556-714 JAENSK010000066.1 2009398-2009556 c 715-829 JAENSK010000066.1 2008118-2008232 c 830-977 JAENSK010000066.1 2006582-2006729 c 978-1673 JAENSK010000066.1 2005148-2005843 c FEATURES Location/Qualifiers source 1..1673 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="3" /map="3" gene 1..1673 /gene="E2F6" /note="E2F transcription factor 6" /db_xref="CGNC:51570" /db_xref="GeneID:421943" exon 1..289 /gene="E2F6" /inference="alignment:Splign:2.1.0" misc_feature 197..199 /gene="E2F6" /note="upstream in-frame stop codon" CDS 224..982 /gene="E2F6" /codon_start=1 /product="transcription factor E2F6" /protein_id="NP_001231667.1" /db_xref="CGNC:51570" /db_xref="GeneID:421943" /translation="
MAAASKWERLRPLRPDTLRLSATPMLDLNLDDDVPVVKKTLKVKRPRFDASLVYLTRKFMDLVKRAPDGVLDLNDVATALGVQKRRVYDITSVLDGIDLIQKRSKNHIQWVGSNLDQVVEMAAQRQNLKDELSDLSAMEEALDELIKDCAHQLFDLTDDKENAKLAYVTYQDIRSIQAFQKQIVIAIKAPEETRLEIPIPKEDCIKVHVKSTKGPIDVYLCEVEQDKPADKNSEDKEAVTSETEPSVPPDEE"
misc_feature 365..559 /gene="E2F6" /note="E2F/DP family winged-helix DNA-binding domain; Region: E2F_TDP; pfam02319" /db_xref="CDD:460530" misc_feature 590..895 /gene="E2F6" /note="Dimerization domain of E2F transcription factors; Region: E2F_DD; cd14660" /db_xref="CDD:271137" misc_feature 590..697 /gene="E2F6" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:271137" misc_feature order(593..598,605..610,614..619,626..631,635..640, 647..652,656..661,665..673,677..682,689..691,713..730, 737..742,749..751,761..787,833..856,860..871,875..877, 893..895) /gene="E2F6" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:271137" misc_feature order(791..820,824..829,836..838) /gene="E2F6" /note="RbC binding site [polypeptide binding]; other site" /db_xref="CDD:271137" exon 290..338 /gene="E2F6" /inference="alignment:Splign:2.1.0" exon 339..555 /gene="E2F6" /inference="alignment:Splign:2.1.0" exon 556..714 /gene="E2F6" /inference="alignment:Splign:2.1.0" exon 715..829 /gene="E2F6" /inference="alignment:Splign:2.1.0" exon 830..977 /gene="E2F6" /inference="alignment:Splign:2.1.0" exon 978..1673 /gene="E2F6" /inference="alignment:Splign:2.1.0" ORIGIN
atccgccgcccagccacccgcaggtgggggagggtaggagtggccgcagcgcctcgcggcgagccaaggcggccccggcaccccctccgcccggaggtggggcggggatggaggcgccttcttcccgcacggtcccgcagcctcatcgggtaggcctctgagtgccctgccgcccctccgaaggccgccgccggcgtgaggtaggaggaggggccgcgcgaacatggccgccgcctccaagtgggagcgcctgaggccgctacggccggacacgctgcgtctgagcgcgacaccaatgcttgacttgaatttggatgatgacgtaccagttgtaaaaaaaactctgaaggtcaaaaggcctcgatttgatgcatccttggtttatttgactcgaaaattcatggatcttgttaaaagagctccagatggtgtccttgatttaaacgacgtagcaacagctcttggagtacaaaaacgaagagtatatgacatcaccagtgtgttggatgggatcgacttaattcagaaaagatcaaagaatcacatccagtgggtaggttctaatcttgaccaagttgttgaaatggcagcacagcggcaaaaccttaaagatgaactttctgacttgtcagccatggaagaagctctggatgaattaatcaaggattgtgctcatcagttatttgatctaacagatgacaaagaaaatgcaaaactagcttatgtgacgtaccaagatatccgtagcattcaggcatttcaaaaacagattgtgattgcaatcaaagctccagaagaaaccagactggaaataccgattcctaaagaggattgcatcaaagtacatgtaaagagcacaaaaggacccattgacgtgtatctgtgtgaggtggaacaagataagccagcagacaaaaattctgaagataaggaagctgtcacttctgaaactgagccatcagttcctcctgatgaagagtgagaggaactacaactgaatctaacaccaaatgtaaatatctgtgttgtagagctcttccaaagctgtttggaactgtaaacttgccaacctgaaatgctccagagtattttgtatttaaaacagcaacggattgagtgcttgcacaggaacgtttaatattcccaagtcagaagacagtggctcctagatttgatattaggagctttgattttataattgcatgtgatctacagagctttgggaaaatggtggttttagtttatgaaataattttaattgatggaaaacgcattcagtaaatggatttgaaaaatgaaggtttgagaactgtttctggaactatttgtaaaccttctgaaaatgtatataataaagaaaatgcacttttcagttctgaggctgcactactatggagaaggattattaaatacagatgaagaaagaactgatgtatcagaagcctttgttatgaggaacaagatgtaaatagtatgagaattatgccttccactgtgtagatactgtttgcattatttgcatccagttctgcattaaatatggtatcaacactgaagttaaataatggctttttgtatatctgtaccatgtccgagtagttactgatgtaggtttattgagatggtttacatttctgcctctgtacagcaaagaaataaactttataaaagca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]