ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-25 01:22:23, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001243724 1375 bp mRNA linear VRT 13-OCT-2024 DEFINITION Gallus gallus retina and anterior neural fold homeobox (RAX), mRNA. ACCESSION NM_001243724 VERSION NM_001243724.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1375) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1375) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1375) AUTHORS Chen,C.M. and Cepko,C.L. TITLE The chicken RaxL gene plays a role in the initiation of photoreceptor differentiation JOURNAL Development 129 (23), 5363-5375 (2002) PUBMED 12403708 REFERENCE 4 (bases 1 to 1375) AUTHORS Ohuchi,H., Tomonari,S., Itoh,H., Mikawa,T. and Noji,S. TITLE Identification of chick rax/rx genes with overlapping patterns of expression during early eye and brain development JOURNAL Mech Dev 85 (1-2), 193-195 (1999) PUBMED 10415362 REFERENCE 5 (bases 1 to 1375) AUTHORS Peale,F.V. Jr., Mason,K., Hunter,A.W. and Bothwell,M. TITLE Multiplex display polymerase chain reaction amplifies and resolves related sequences sharing a single moderately conserved domain JOURNAL Anal Biochem 256 (2), 158-168 (1998) PUBMED 9473273 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000086.1. On Nov 27, 2021 this sequence version replaced NM_001243724.1. ##Evidence-Data-START## Transcript exon combination :: AF420600.1, AB020318.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992393, SAMEA103992482 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: upstream AUG and CDS extension is not conserved ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-448 JAENSK010000086.1 968323-968770 c 449-678 JAENSK010000086.1 967999-968228 c 679-1375 JAENSK010000086.1 966918-967614 c FEATURES Location/Qualifiers source 1..1375 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="Z" /map="Z" gene 1..1375 /gene="RAX" /gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2" /note="retina and anterior neural fold homeobox" /db_xref="CGNC:62091" /db_xref="GeneID:100677794" exon 1..448 /gene="RAX" /gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2" /inference="alignment:Splign:2.1.0" misc_feature 19..21 /gene="RAX" /gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2" /note="upstream_AUG_codon; putative N-terminal extension: MPCLPPPGRSGAGPRLPCRPPPLGTPPPPRGGQPAAPRRAVPEPPAPPRAGRP" CDS 178..1131 /gene="RAX" /gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2" /note="retinal homeobox protein Rx2; orthodenticle-related homeobox protein" /codon_start=1 /product="retinal homeobox protein Rx1" /protein_id="NP_001230653.1" /db_xref="CGNC:62091" /db_xref="GeneID:100677794" /translation="
MHPPGAPLAMAEGAFSLSAPAARSPGGNPSRLHSIEAILGFTKDDGLLGPFQPDGGAGSAKEAADKRGPRHCLPKGPAEPPPAEHQGRFQEPYCPGSASPELPAGDGGDGKPSDEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQDSPILSFSRSPQAAPVGALGGSLPLETWLGPPVPGGAALQSLPGFAAPPQGLPASYTPPPFLNSPAVTHALQPLGAMGPPPPYQCGAAFVDKFPLDEGDPRNTSIASLRMKAKEHIQSIGKPWQTI"
misc_feature 274..297
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="propagated from UniProtKB/Swiss-Prot (Q9PVX0.1);
Region: Octapeptide motif"
misc_feature 307..558
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="propagated from UniProtKB/Swiss-Prot (Q9PVX0.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 544..714
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 1045..1095
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="OAR motif; Region: OAR; pfam03826"
/db_xref="CDD:461067"
misc_feature 1057..1098
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="propagated from UniProtKB/Swiss-Prot (Q9PVX0.1);
Region: OAR.
/evidence=ECO:0000255|PROSITE-ProRule:PRU00138"
misc_feature 1075..1089
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/note="propagated from UniProtKB/Swiss-Prot (Q9PVX0.1);
Region: Nuclear localization signal.
/evidence=ECO:0000255"
exon 449..678
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/inference="alignment:Splign:2.1.0"
exon 679..1375
/gene="RAX"
/gene_synonym="cRax; cRax1; cRax2; orx; RAX2; RX1; RX2"
/inference="alignment:Splign:2.1.0"
ORIGIN
gccggcggggccctggggatgccctgcctccccccgccgggccggagcggcgcggggcctcgccttccctgtcgcccaccgcccctcggcactcctcccccgccccgaggagggcagcccgccgcgccgcgccgtgccgtgccagagccgcccgcgccgccccgggccggccgccccatgcaccctcccggcgccccgctcgccatggccgagggcgctttctcgctgtcggctccggcggcgcgcagccccggggggaacccgtcgaggctgcacagcatcgaggccatcctggggttcaccaaggatgacggcctcctgggccccttccagcccgacggcggcgccggcagcgccaaggaggcggcggacaagcgggggccgcggcactgcctcccgaagggacccgcggagccgccgccggctgagcaccagggccgcttccaagagccgtactgcccgggcagcgccagccccgagctgcccgccggcgacggcggcgacgggaagccgtcggacgaggagcagcccaagaagaagcaccggcggaaccgcaccaccttcaccacctaccagctccacgagctggagcgcgccttcgagaagtcgcactaccccgacgtgtacagccgcgaggagctggccatgaaggtcaacctgcccgaggtccgcgtgcaggtgtggtttcagaaccgtcgggccaagtggcggcggcaggagaagctggaggtgagctccatgaagctgcaggactcgccgatcctctccttcagccgctccccgcaggcggccccggtgggcgcgctgggcggcagcctgccgctggagacgtggctcggtccgcccgtgcccggcggcgcggccctgcagagcctgcccggcttcgcggcccctcctcaggggctgcctgccagctacacaccaccacccttcctgaactctccggccgtgacccacgcgctgcagcccctgggagccatggggccgccgccgccctaccagtgcggggccgcctttgtggacaagttccccctggacgaaggggacccgcgcaacaccagcattgcctccttgcgtatgaaggccaaggagcacatccagtccatcggcaagccctggcagaccatctgagccccctccctgcactgggatgcggccgccgagagcgccggtgccgggaggccgtgggacgcccccgacccgctccgctgccgacatcaccgcgcgtcccgactttgtatttcgtggtcctctgaaccccctttgccgtgtgccccgcggagctggggccgggctgtagcttaggaagagctctcccactgtcccttgttggctggatgctttagtcgcaataaaagctgcagtagggcgcaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]