2024-07-01 22:29:00, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001006388 1185 bp mRNA linear VRT 17-FEB-2024 DEFINITION Gallus gallus mitochondrial ribosomal protein L15 (MRPL15), mRNA. ACCESSION NM_001006388 XM_419204 VERSION NM_001006388.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1185) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1185) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1185) AUTHORS Caldwell,R.B., Kierzek,A.M., Arakawa,H., Bezzubov,Y., Zaim,J., Fiedler,P., Kutter,S., Blagodatski,A., Kostovska,D., Koter,M., Plachy,J., Carninci,P., Hayashizaki,Y. and Buerstedde,J.M. TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis JOURNAL Genome Biol 6 (1), R6 (2005) PUBMED 15642098 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000043.1. On Sep 23, 2021 this sequence version replaced NM_001006388.1. ##Evidence-Data-START## Transcript exon combination :: AJ719996.1, CO635611.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-165 JAENSK010000043.1 12955894-12956058 166-323 JAENSK010000043.1 12959247-12959404 324-489 JAENSK010000043.1 12961647-12961812 490-613 JAENSK010000043.1 12962290-12962413 614-1185 JAENSK010000043.1 12963761-12964332 FEATURES Location/Qualifiers source 1..1185 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="2" /map="2" gene 1..1185 /gene="MRPL15" /note="mitochondrial ribosomal protein L15" /db_xref="CGNC:11375" /db_xref="GeneID:421121" exon 1..165 /gene="MRPL15" /inference="alignment:Splign:2.1.0" CDS 58..951 /gene="MRPL15" /EC_number="3.6.5.3" /note="39S ribosomal protein L15, mitochondrial; L15mt; MRP-L15; large ribosomal subunit protein uL15m" /codon_start=1 /product="large ribosomal subunit protein uL15m precursor" /protein_id="NP_001006388.2" /db_xref="CGNC:11375" /db_xref="GeneID:421121" /translation="
MSGNGVHGVHGALQLLRSLPKVSLANLRPNPGSKKPERRRGRGRYRGRKCGRGHKGERQRGNRPRLGFEGGQTPFYLSIPKYGFNEGHSCRRQYHPLSLQKLQYLIDLGRVDPTQPIDLTQLTNARGVTVQPLKRDYGVQLVEEGADIFAAKINIEVQRASELAIAAIEKNGGVVTTSFYDPRSLEILIRPVPFFLRGQPIPKRMLPPEDLVRYYTDASNRGYLADPSKVAEARLELAKKYGYTLPDITKDELFKMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDERLLKYYSS"
transit_peptide 58..120 /gene="MRPL15" /note="Mitochondrion. /evidence=ECO:0000250|UniProtKB:Q0VC21; propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1)" mat_peptide 121..948 /gene="MRPL15" /product="Large ribosomal subunit protein uL15m. /id=PRO_0000257841" /note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1)" misc_feature 124..264 /gene="MRPL15" /note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 217..585 /gene="MRPL15" /note="Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; Region: Ribosomal_L27A; pfam00828" /db_xref="CDD:459951" exon 166..323 /gene="MRPL15" /inference="alignment:Splign:2.1.0" exon 324..489 /gene="MRPL15" /inference="alignment:Splign:2.1.0" exon 490..613 /gene="MRPL15" /inference="alignment:Splign:2.1.0" exon 614..1185 /gene="MRPL15" /inference="alignment:Splign:2.1.0" ORIGIN
gccgtaaagcagctctgcctgcggagcgctgtcgtcgtccttgggagggcagtggcgatgagcgggaatggtgtgcacggcgtgcatggggctctgcaactgctgcggtcgctgcctaaggtcagcctggccaacctgaggcccaatccgggttcaaaaaagccggagagaagacgtggccgtggacgatacagaggtagaaagtgtggtcgaggtcacaaaggggaaagacaaagaggaaatcgcccccgcttaggctttgaaggtggccaaactccattttatttgtctataccaaaatacgggtttaatgagggacatagctgccgacgtcagtatcatccactcagtcttcagaagctgcagtacctgattgatttgggtagagttgaccctacgcaaccaattgacttaacacagcttactaatgctagaggtgtaacagtacaacctctcaaacgggattatggtgtccagctggtggaggagggtgctgatatctttgcagcaaaaataaatattgaagtgcagagggcgtccgaattagcaattgcagctatagaaaaaaatggcggtgttgttacgacatcgttctatgatccaaggagtttggagattttaattaggccagtcccgttttttctgcgtggccagcctattccaaagcgaatgcttccccctgaagacctagtacgttactacacagatgccagtaatcgtgggtacctggcagatccatctaaggttgcagaagccagacttgaacttgccaagaagtacggatataccttaccagacataactaaggatgagctcttcaaaatgttaagtacgcgcaaagaccctaggcagatattttttggtcttgctccaggatggatcgtaaacatggcagacaagaaaattctgaagccaactgatgagaggctgctaaaatactatagctcgtgaattcaggactggagacaactgcaggtgtacaggaaacatctggatatgaaataatggatacaaagtggtgtttgttttttttaagactcctgttataccagacaaaacagaagtttttgtttatgtaatctactggtgtcgcttttgctgtttttgattgtcataatactgcgtatgaaaaatgttaacagttggaagcagtgtggagtctgaaataaagcatgtatttgggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]