GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-01 22:29:00, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_001006388            1185 bp    mRNA    linear   VRT 17-FEB-2024
DEFINITION  Gallus gallus mitochondrial ribosomal protein L15 (MRPL15), mRNA.
ACCESSION   NM_001006388 XM_419204
VERSION     NM_001006388.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1185)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1185)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1185)
  AUTHORS   Caldwell,R.B., Kierzek,A.M., Arakawa,H., Bezzubov,Y., Zaim,J.,
            Fiedler,P., Kutter,S., Blagodatski,A., Kostovska,D., Koter,M.,
            Plachy,J., Carninci,P., Hayashizaki,Y. and Buerstedde,J.M.
  TITLE     Full-length cDNAs from chicken bursal lymphocytes to facilitate
            gene function analysis
  JOURNAL   Genome Biol 6 (1), R6 (2005)
   PUBMED   15642098
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000043.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001006388.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ719996.1, CO635611.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-165               JAENSK010000043.1  12955894-12956058
            166-323             JAENSK010000043.1  12959247-12959404
            324-489             JAENSK010000043.1  12961647-12961812
            490-613             JAENSK010000043.1  12962290-12962413
            614-1185            JAENSK010000043.1  12963761-12964332
FEATURES             Location/Qualifiers
     source          1..1185
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..1185
                     /gene="MRPL15"
                     /note="mitochondrial ribosomal protein L15"
                     /db_xref="CGNC:11375"
                     /db_xref="GeneID:421121"
     exon            1..165
                     /gene="MRPL15"
                     /inference="alignment:Splign:2.1.0"
     CDS             58..951
                     /gene="MRPL15"
                     /EC_number="3.6.5.3"
                     /note="39S ribosomal protein L15, mitochondrial; L15mt;
                     MRP-L15; large ribosomal subunit protein uL15m"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL15m precursor"
                     /protein_id="NP_001006388.2"
                     /db_xref="CGNC:11375"
                     /db_xref="GeneID:421121"
                     /translation="
MSGNGVHGVHGALQLLRSLPKVSLANLRPNPGSKKPERRRGRGRYRGRKCGRGHKGERQRGNRPRLGFEGGQTPFYLSIPKYGFNEGHSCRRQYHPLSLQKLQYLIDLGRVDPTQPIDLTQLTNARGVTVQPLKRDYGVQLVEEGADIFAAKINIEVQRASELAIAAIEKNGGVVTTSFYDPRSLEILIRPVPFFLRGQPIPKRMLPPEDLVRYYTDASNRGYLADPSKVAEARLELAKKYGYTLPDITKDELFKMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDERLLKYYSS"
     transit_peptide 58..120
                     /gene="MRPL15"
                     /note="Mitochondrion.
                     /evidence=ECO:0000250|UniProtKB:Q0VC21; propagated from
                     UniProtKB/Swiss-Prot (Q5ZKT8.1)"
     mat_peptide     121..948
                     /gene="MRPL15"
                     /product="Large ribosomal subunit protein uL15m.
                     /id=PRO_0000257841"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1)"
     misc_feature    124..264
                     /gene="MRPL15"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    217..585
                     /gene="MRPL15"
                     /note="Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A;
                     Region: Ribosomal_L27A; pfam00828"
                     /db_xref="CDD:459951"
     exon            166..323
                     /gene="MRPL15"
                     /inference="alignment:Splign:2.1.0"
     exon            324..489
                     /gene="MRPL15"
                     /inference="alignment:Splign:2.1.0"
     exon            490..613
                     /gene="MRPL15"
                     /inference="alignment:Splign:2.1.0"
     exon            614..1185
                     /gene="MRPL15"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gccgtaaagcagctctgcctgcggagcgctgtcgtcgtccttgggagggcagtggcgatgagcgggaatggtgtgcacggcgtgcatggggctctgcaactgctgcggtcgctgcctaaggtcagcctggccaacctgaggcccaatccgggttcaaaaaagccggagagaagacgtggccgtggacgatacagaggtagaaagtgtggtcgaggtcacaaaggggaaagacaaagaggaaatcgcccccgcttaggctttgaaggtggccaaactccattttatttgtctataccaaaatacgggtttaatgagggacatagctgccgacgtcagtatcatccactcagtcttcagaagctgcagtacctgattgatttgggtagagttgaccctacgcaaccaattgacttaacacagcttactaatgctagaggtgtaacagtacaacctctcaaacgggattatggtgtccagctggtggaggagggtgctgatatctttgcagcaaaaataaatattgaagtgcagagggcgtccgaattagcaattgcagctatagaaaaaaatggcggtgttgttacgacatcgttctatgatccaaggagtttggagattttaattaggccagtcccgttttttctgcgtggccagcctattccaaagcgaatgcttccccctgaagacctagtacgttactacacagatgccagtaatcgtgggtacctggcagatccatctaaggttgcagaagccagacttgaacttgccaagaagtacggatataccttaccagacataactaaggatgagctcttcaaaatgttaagtacgcgcaaagaccctaggcagatattttttggtcttgctccaggatggatcgtaaacatggcagacaagaaaattctgaagccaactgatgagaggctgctaaaatactatagctcgtgaattcaggactggagacaactgcaggtgtacaggaaacatctggatatgaaataatggatacaaagtggtgtttgttttttttaagactcctgttataccagacaaaacagaagtttttgtttatgtaatctactggtgtcgcttttgctgtttttgattgtcataatactgcgtatgaaaaatgttaacagttggaagcagtgtggagtctgaaataaagcatgtatttgggca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]