GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-15 03:22:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_057283325             294 bp    mRNA    linear   PLN 12-JUN-2023
DEFINITION  Penicillium samsonianum RNA interference and gene silencing protein
            (N7471_010606), partial mRNA.
ACCESSION   XM_057283325
VERSION     XM_057283325.1
DBLINK      BioProject: PRJNA973687
            BioSample: SAMN30185370
KEYWORDS    RefSeq.
SOURCE      Penicillium samsonianum
  ORGANISM  Penicillium samsonianum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Penicillium.
REFERENCE   1  (bases 1 to 294)
  AUTHORS   Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E.,
            Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L.
  TITLE     Comparative genomic study of the Penicillium genus elucidates a
            diverse pangenome and 15 lateral gene transfer events
  JOURNAL   IMA Fungus 14 (1), 3 (2023)
   PUBMED   36726175
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 294)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUN-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 294)
  AUTHORS   Petersen,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2023) Department of Chemistry and Bioscience,
            Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland
            9220, Denmark
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026643264).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..294
                     /organism="Penicillium samsonianum"
                     /mol_type="mRNA"
                     /strain="IBT 33392"
                     /culture_collection="IBT:33392"
                     /type_material="culture from holotype of Penicillium
                     samsonianum"
                     /db_xref="taxon:1882272"
                     /chromosome="Unknown"
     gene            <1..>294
                     /locus_tag="N7471_010606"
                     /db_xref="GeneID:81935107"
     CDS             1..294
                     /locus_tag="N7471_010606"
                     /note="Argonaute linker 1 domain"
                     /codon_start=1
                     /product="RNA interference and gene silencing protein"
                     /protein_id="XP_057132304.1"
                     /db_xref="GeneID:81935107"
                     /translation="
MREYMEYLTNSGLGGNKHCSLDASTGEKAALGGGLEALRGFFVSVRAATAQVLLNVQVKYLARYQEGPLPMVIGDYQRANPRSLYPLKSFFEAHACP"
     misc_feature    <94..195
                     /locus_tag="N7471_010606"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:430160"
ORIGIN      
atgagagaatacatggagtatttaacaaattcaggtcttggtggtaacaagcattgcagcctggatgcctccacaggcgaaaaagccgctttgggcggcggtttggaagctctgcgtggtttcttcgtcagtgtccgtgcggccactgctcaggtgctattgaatgtccaagtcaagtatctggcccgctaccaagagggtcctctgccgatggtgattggagattaccagcgcgcaaatccgcgcagcctttacccgctaaagtctttttttgaggcacatgcgtgtccgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]