2024-05-16 00:08:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_032843692 414 bp mRNA linear MAM 14-MAR-2020 DEFINITION PREDICTED: Lontra canadensis late cornified envelope protein 1A-like (LOC116858788), mRNA. ACCESSION XM_032843692 VERSION XM_032843692.1 DBLINK BioProject: PRJNA611578 KEYWORDS RefSeq; includes ab initio. SOURCE Lontra canadensis (Northern American river otter) ORGANISM Lontra canadensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Musteloidea; Mustelidae; Lutrinae; Lontra. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022631136.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Lontra canadensis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..414 /organism="Lontra canadensis" /mol_type="mRNA" /isolate="GAN:19392208" /db_xref="taxon:76717" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" gene 1..414 /gene="LOC116858788" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:116858788" CDS 1..414 /gene="LOC116858788" /codon_start=1 /product="late cornified envelope protein 1A-like" /protein_id="XP_032699583.1" /db_xref="GeneID:116858788" /translation="
MGPKVQNRSYEAFQVALAKENEAENQTSDSISEMSYQQNQQQCQSPPKCPTPKCPPKCPPKCPSISSCCSVSSGGCCSSSSGGRSCCSFGGGSSCLSHHRRHRSHCHRCQSSGCCSQPSGGSSCCGGGSSQSSGGCC"
ORIGIN
atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]