GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-14 14:20:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006771772             785 bp    mRNA    linear   MAM 09-FEB-2016
DEFINITION  PREDICTED: Myotis davidii VCP interacting membrane selenoprotein
            (VIMP), mRNA.
ACCESSION   XM_006771772
VERSION     XM_006771772.2
DBLINK      BioProject: PRJNA232515
KEYWORDS    RefSeq.
SOURCE      Myotis davidii
  ORGANISM  Myotis davidii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera;
            Vespertilionidae; Myotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006296417.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 9, 2016 this sequence version replaced XM_006771772.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Myotis davidii Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..785
                     /organism="Myotis davidii"
                     /mol_type="mRNA"
                     /db_xref="taxon:225400"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="spleen, kidney and small intestine"
                     /country="China: Taiyi Cave, Xianning, Wuhan, Hubei
                     Province"
                     /collection_date="21-Aug-2011"
     gene            1..785
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 43 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:102768176"
     CDS             93..395
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_006771835.2"
                     /db_xref="GeneID:102768176"
                     /translation="
MQEELNAQVERHKEKLRQLEEEKRRRKIEMWDSLQEGKSYRGHARKPQEEDNPSPSTSSSLPKRPADRKPLRGGGYNPLSGEGGGACTWRPGRRGPSAGG"
     misc_feature    <93..392
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
ORIGIN      
ccaggcagaggcggccggacccggcggcggctgctgtagctcccgaggacgttgtgagacggcaggaggctttggcggccgcgcgcctgaaaatgcaggaggaactaaacgcccaagtagaaaggcacaaggagaaactccggcagcttgaggaagagaaacggagaaggaagattgaaatgtgggacagcctgcaagaggggaaaagctacagaggtcatgccaggaagcctcaggaagaagacaaccccagcccttctacttcgtccagcctccccaagcggccagcagacaggaagcccctacgtgggggtggttataaccctttgtctggggaaggaggaggagcctgcacgtggcgacctggacgccgaggcccatcagctggcggatgaggctaagaaagccttgcccgtgtcactcgacacgaagcaagcccagccctcaccccaatccccttcaattgccttacgcaccctttctcacagtgaccaaggggctcactcctgtcctccacctgcacagcacccaccaggcaacagcgggtccccacctccgaaggaggcacctgacccaatcaagaacactgggacctagaggaacagccccctctcacagcccttggctgctgctaggacagtctctgtgataggttgcgtcgaatgacgtcctccttgtaaatggtgaagccaccaccaaggattaccgaggctcacagttgacggggtttctgtagatctgcacagaacactttgccaggtataaacgtttttaaagctgctgtc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]