GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-15 20:21:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_210741                303 bp    mRNA    linear   PLN 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 60S ribosomal protein L36
            (AGOS_AFL163C), partial mRNA.
ACCESSION   NM_210741
VERSION     NM_210741.1
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 303)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 303)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 303)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_005787).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="mRNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="VI"
     gene            <1..>303
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /db_xref="GeneID:4621613"
     CDS             1..303
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL249C-A (RPL36B) and YMR194W (RPL36A); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="NP_985387.1"
                     /db_xref="GeneID:4621613"
                     /translation="
MAVKSGIAVGLNKGKKVTPMTPAPKVSYRKGASSKRTTFVRSIVREVAGMAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNEIIAASRRH"
     misc_feature    13..297
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:426088"
ORIGIN      
atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]