GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-14 17:29:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001113219            1675 bp    mRNA    linear   MAM 22-DEC-2022
DEFINITION  Sus scrofa MOS proto-oncogene, serine/threonine kinase (MOS), mRNA.
ACCESSION   NM_001113219
VERSION     NM_001113219.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 1675)
  AUTHORS   Nishimura T, Shimaoka T, Kano K and Naito K.
  TITLE     Insufficient amount of Cdc2 and continuous activation of Wee1 B are
            the cause of meiotic failure in porcine growing oocytes
  JOURNAL   J Reprod Dev 55 (5), 553-557 (2009)
   PUBMED   19550110
REFERENCE   2  (bases 1 to 1675)
  AUTHORS   Dai Y, Newman B and Moor R.
  TITLE     Translational regulation of MOS messenger RNA in pig oocytes
  JOURNAL   Biol Reprod 73 (5), 997-1003 (2005)
   PUBMED   15987821
  REMARK    GeneRIF: the length of the MOS 3'-UTR tightly controls the level of
            translation during oocyte maturation.  two U-rich (U5A) elements
            and the hexanucleotide signal (AAUAAA) are required for
            translation.
REFERENCE   3  (bases 1 to 1675)
  AUTHORS   Ohashi S, Naito K, Sugiura K, Iwamori N, Goto S, Naruoka H and Tojo
            H.
  TITLE     Analyses of mitogen-activated protein kinase function in the
            maturation of porcine oocytes
  JOURNAL   Biol Reprod 68 (2), 604-609 (2003)
   PUBMED   12533425
REFERENCE   4  (bases 1 to 1675)
  AUTHORS   Newman B and Dai Y.
  TITLE     Transcription of c-mos protooncogene in the pig involves both
            tissue-specific promoters and alternative polyadenylation sites
  JOURNAL   Mol Reprod Dev 44 (3), 275-288 (1996)
   PUBMED   8858597
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X78318.1.
FEATURES             Location/Qualifiers
     source          1..1675
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="4"
                     /map="4"
     gene            1..1675
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="MOS proto-oncogene, serine/threonine kinase"
                     /db_xref="GeneID:100127484"
                     /db_xref="VGNC:VGNC:90312"
     exon            1..1675
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    93..95
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="upstream in-frame stop codon"
     CDS             174..1211
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /EC_number="2.7.11.1"
                     /note="oocyte maturation factor mos; proto-oncogene c-Mos;
                     v-mos Moloney murine sarcoma viral oncogene homolog"
                     /codon_start=1
                     /product="proto-oncogene serine/threonine-protein kinase
                     mos"
                     /protein_id="NP_001106690.1"
                     /db_xref="GeneID:100127484"
                     /db_xref="VGNC:VGNC:90312"
                     /translation="
MPSPFPRRRCLPGDFSPSVDSRPCSSPCELPGPTGKLFLGGTPPRALRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSRCTKNRLASQRSFWAELNIARLRHANIVRVVAASTRTPAAFDSLGSIIMEFGGNVTLHQVIYGATGCPEEDGPPCSAGEQLNLEKCLKYSLDVVSGLLFLHSQGIVHLDLKPANILISEQDVCKISDFGCSERLEDLRFRPRHHLGGTYTHRAPELLKGEPVTPKADIYSFAITLWQMTTRQVPYSGERQHVLYAVVAYNLRPSLSAAVFTESVPGKKLEDIIQCGWTAPAQQRPSAQLLLLDLRALQAELG"
     misc_feature    348..1160
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="Catalytic domain of the Serine/Threonine kinase,
                     Oocyte maturation factor Mos; Region: STKc_Mos; cd13979"
                     /db_xref="CDD:270881"
     misc_feature    order(378..392,402..404,435..437,441..443,534..536,
                     597..608,618..620,624..626,777..779,783..785,789..794,
                     798..800,831..833,840..842,891..902)
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="active site"
                     /db_xref="CDD:270881"
     misc_feature    order(378..392,402..404,435..437,441..443,534..536,
                     597..608,618..620,777..779,783..785,789..794,798..800,
                     831..833)
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270881"
     misc_feature    order(390..392,618..620,624..626,777..779,783..785,
                     789..791,840..842,891..902)
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270881"
     misc_feature    order(828..869,882..902)
                     /gene="MOS"
                     /gene_synonym="c-mos; p39-mos"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270881"
ORIGIN      
cgctgagtaacagcacagatgtggctcatctgcggaagatggaggcagaggagaaaagcgctgggccggggcgcggagcggcaggtggtcagtgatgcttgcacgcccgcccgctgggtcttctcttccctcctatcccacccaagccgcggcgggctgccctccgcagggcgatgccctcacctttccctcggcgccggtgcctgcctggcgacttctccccgtcggtggactcgcggccctgcagcagcccctgcgagctcccggggccgacagggaagctcttcctggggggcaccccaccccgggccctgcgccttcctcgccggctggcctggtgctcaatagactgggaacaggtgtgcctgctgcagcggctgggagccgggggcttcggctcggtatacaaggccacctaccacggcgtgcctgtggccatcaaacaggtgagcagatgcaccaagaaccggctggcatcccagcgcagtttctgggccgagctcaacatcgctcggctccgccacgccaatatcgtgcgcgtggtggccgccagcacgcgcacacccgcggcctttgacagcctgggcagcatcatcatggagttcggcggcaacgtcaccttacaccaggtcatctacggcgctacgggctgtccagaggaggatgggcctccctgcagtgctggggagcaactgaacttggagaagtgtctcaagtattccctggatgtggtcagtggcctgcttttcctgcactcccaaggcattgtgcacttggacctgaagccagcgaacattctgatcagtgagcaggacgtctgcaaaatcagcgactttggttgctccgagaggctggaagatctgcgcttccggcctcggcaccacctgggcggcacgtacacccaccgagcccccgagctcctcaaaggcgagcccgtcaccccaaaagcggacatctactcctttgccatcaccctctggcagatgaccactaggcaggtgccttactcaggggagcgtcagcacgtgctctacgcggtggtggcctacaatctccgtccgtccctctcggcggcggtcttcaccgagtccgtccctgggaagaaactggaggacatcatccagtgcggctggacggcccctgcgcagcagcggcccagcgcacaactcctcctgctggaccttcgcgctctacaagctgaactgggctgacccgaaacgtgtggccggataagcatttgtctttgttgctgttcatttttaacaagagaagatgtaggcaaaaaaaaaaaaacaaaaacaaaaacaaaaaacatagaggtaggatggatttttagaaaataaagttaccaaaaactcctttcaccccaaatgcttttcctaagacaaacagcagaactagaaatctagtggtgtctctccttctccctttacagagctctgtgtttgcttcagagctactgtgcttccttgcagttccatagtactgcacttaactcaaatttgttattggtctgttaacagtttacttgctcccgtacaaataagctaaaaaacaaagattaatttttccctcctgctcttcccccaaaactacttgtttctaatgatcttcacacatacagttcgcaagttgaggtaagcttgtttttaaaaggaatgatactttaaatgat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]