GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 19:45:15, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_073914792             627 bp    mRNA    linear   VRT 12-MAY-2025
DEFINITION  PREDICTED: Danio rerio large ribosomal subunit protein uL6-like
            (LOC798685), mRNA.
ACCESSION   XM_073914792
VERSION     XM_073914792.1
DBLINK      BioProject: PRJNA1248012
KEYWORDS    RefSeq; corrected model.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_133185) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_049306965.1-RS_2025_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/11/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts          :: corrected 2 indels
            internal stop codons :: corrected 5 genomic stop codons
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-164               JBMGRA010000010.1  30890293-30890456
            165-275             JBMGRA010000010.1  30890458-30890568
            276-277             "NN"               1-2
            278-627             JBMGRA010000010.1  30890569-30890918
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /isolation_source="Zebrafish international resource
                     center"
                     /db_xref="taxon:7955"
                     /chromosome="10"
                     /sex="male"
                     /tissue_type="Fibroblasts and whole tissue"
                     /dev_stage="adult"
                     /ecotype="United States"
                     /geo_loc_name="USA"
                     /collection_date="2022-07-19"
                     /collected_by="National Human Genome Research Institute"
                     /genotype="Double heterozygous"
     gene            1..627
                     /gene="LOC798685"
                     /note="large ribosomal subunit protein uL6-like; The
                     sequence of the model RefSeq transcript was modified
                     relative to its source genomic sequence to represent the
                     inferred CDS: inserted 2 bases in 1 codon; deleted 1 base
                     in 1 codon; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 15 Proteins"
                     /db_xref="GeneID:798685"
     misc_feature    1
                     /gene="LOC798685"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             12..590
                     /gene="LOC798685"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon;
                     deleted 1 base in 1 codon; substituted 5 bases at 5
                     genomic stop codons"
                     /codon_start=1
                     /transl_except=(pos:93..95,aa:OTHER)
                     /transl_except=(pos:120..122,aa:OTHER)
                     /transl_except=(pos:462..464,aa:OTHER)
                     /transl_except=(pos:492..494,aa:OTHER)
                     /transl_except=(pos:525..527,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: large ribosomal subunit
                     protein uL6-like"
                     /protein_id="XP_073770893.1"
                     /db_xref="GeneID:798685"
                     /translation="
MKTILSKQTVDTPDNVMLSLKGRTVTIXGPSTVLYQXFNHINLELSLLGKKRKKLRVDKWWVKRKELATVRSICSHVQNMIKGVNLGFXKILSVYDHFPINVVIQESGSLMEIRNFLGEKCIHHVRMRQGVVCAVSATQKDELVLEDNYMXLVSNSTALIXQATTVRKKDIXKFLDGIYVSEKGTVVEQQED"
ORIGIN      
aatctgcgagaatgaagaccattctcagtaagcagacagtggacaccccagacaatgtcatgctgtccctcaagggccgcacagttaccatttagggacccagtactgttctctaccagtagttcaaccacattaacctggaactcagtctgttgggcaagaaaagaaaaaagctgcgtgtggataagtggtgggttaaaagaaaagagttggccacagtccgcagcatctgcagtcatgtccagaacatgatcaagggggtcaacctgggctttnncaaaatactatctgtatatgaccattttcccattaatgtggtcatccaagagtctggctcactgatggagatcagaaacttcttgggagagaagtgcatccaccatgtccgcatgaggcaaggagttgtgtgtgcagtgtctgccactcaaaaagatgagttggttttggaggataattacatgtagctggtatcaaactcaactgctctgatctagcaggccaccactgtgagaaagaaagacatctgaaagttcctggatgggatttatgtcagcgagaagggcacagtggtggaacagcaagaggactaaattagtctctgtaaaatctgtcaataaagacaattcc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]