LOCUS       XM_068216433             824 bp    mRNA    linear   VRT 08-SEP-2024
DEFINITION  PREDICTED: Danio rerio protein shisa-5-like (LOC137488908),
            transcript variant X1, mRNA.
ACCESSION   XM_068216433
VERSION     XM_068216433.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007133.7) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000002035.6-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/15/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="22"
     gene            1..824
                     /gene="LOC137488908"
                     /note="protein shisa-5-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     mRNA, and 100% coverage of the annotated genomic feature
                     by RNAseq alignments, including 7 samples with support for
                     all annotated introns"
                     /db_xref="GeneID:137488908"
     CDS             70..726
                     /gene="LOC137488908"
                     /codon_start=1
                     /product="protein shisa-5-like isoform X1"
                     /protein_id="XP_068072534.1"
                     /db_xref="GeneID:137488908"
                     /translation="

MVYAVMFLLCLSAVIFKVTLALEDCTSYNASRGDLVLCSRRSFFCCGTCDKMYCCNNRKEKITKDELNDCLSNNTLPSHSPHQLDRTVFIEPIVMFLVFIVIVFIIICCSEKRIRNRLMSTTTVTTTQHNPQEGLYSAYQPVFNNPQSPTMPMGQLYAPGPPPSYHEAAGCPCPISQSAYDSGQVLYSIQPTEAQPPLSIDYNPPAYNPAYVNSLKTS"

ORIGIN      

attaattctgcagtctccggaaatacgccatgtacactaaacccagcactaaatgggaagagctgcgctatggtgtacgcagtcatgtttcttctgtgcctttctgcggttatattcaaagtgacattagctcttgaggattgtacatcctacaatgccagcaggggtgatcttgtattgtgtagcagaaggtctttcttctgctgtgggacgtgcgataagatgtactgctgcaacaatcggaaggaaaaaataaccaaagatgaactaaacgactgtctttcaaacaacaccttgccaagtcattctccccatcaactggaccgaacagtgttcattgagcccatagtcatgtttttagtgtttatcgtcattgtgttcatcatcatctgctgcagtgaaaaaaggatcagaaacagactgatgtcgacaactacagtcacgactacacaacacaatccccaagaaggcctgtactccgcttaccagcctgtgtttaataatccacaatcacccactatgccaatggggcagctttatgcaccgggacctccgccttcataccatgaggctgcagggtgtccttgtcccatcagccagtctgcatatgacagtggtcaagtcttgtactccatacaaccaacagaagctcaaccaccgctgtccatagattacaatccaccagcttacaaccctgcttacgtgaattcactaaagacctcttaatccacatcaggctgttcctctgcatggctgcaactgttactcgaaaaacaaaacagtgcattagttccatgaacctaacctgagactacagacacgtc

//