2025-02-07 00:12:09, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS XM_068215339 880 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio claudin 35 (cldn35), mRNA. ACCESSION XM_068215339 VERSION XM_068215339.1 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007130.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..880 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="19" gene 1..880 /gene="cldn35" /note="claudin 35; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 63 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:570842" /db_xref="ZFIN:ZDB-GENE-141212-295" CDS 83..769 /gene="cldn35" /codon_start=1 /product="claudin-4" /protein_id="XP_068071440.1" /db_xref="GeneID:570842" /db_xref="ZFIN:ZDB-GENE-141212-295" /translation="
MVNTGMQLISFTCAVTGWIMAIAVTALPQWKVTAFIGSNILTSEIVWQGIWMNCIYQTTGHMQCKTYDSMLALPPDIQAARALMCIAIFLGWLSCTVSCCGMKCTTCAGDDRHAKAGIALSGGVLFILTGLCVLVPVSWTANTVVQDFYNPNVPLQHKRELGQAIYLGWAAAVILMISGAVLSSTCPHIERGGYRRGYIGRSFANSRPSAPDPPKPITNSTLPLKEYV"
ORIGIN
atccccgactggaccttttgcaaacgtaaaggtgtcttcgaggttgtggcccgaggaggcgtggtactcagagggaggcgagatggtaaacacgggcatgcagttgatcagcttcacctgtgctgtaactggctggattatggctatagcggtgaccgcgttaccccaatggaaggtcactgctttcatcggcagcaatatcctaacctcggagatcgtctggcaggggatctggatgaactgcatctaccagaccaccgggcacatgcaatgtaaaacctacgactccatgttggctctaccgcctgatatacaagctgcacgggcgctgatgtgcattgcaattttcttgggctggttgtcctgcacagtttcttgctgtggaatgaagtgcaccacctgtgccggggatgatcgccatgctaaggctggcatagcgttatccggcggggtgcttttcatcctgacgggactttgcgtcctggtgccagtttcctggacagcaaacactgtggtgcaggacttctacaaccccaatgtcccgctccagcataaacgggagctcggacaggctatttacctgggctgggcggcggcggtgatcctcatgatcagtggtgccgttttaagcagcacctgcccacatatagagcgcggcgggtacaggcgcgggtacataggccgcagttttgctaactccaggccttctgctcctgatcctcccaagccgattaccaacagcaccttgcctcttaaggagtatgtatgattaaaaaccaacttgagatcaaatttaaaggtcccgtgaagtttttgtagatgttcgaatcagtatgttaagtttcaaggatgcctataaactagtgcgtatcaaatattt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]