GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-01-31 06:59:09, GGRNA.v2 : RefSeq release 227 (Nov, 2024)

LOCUS       XM_005170906             665 bp    mRNA    linear   VRT 08-SEP-2024
DEFINITION  PREDICTED: Danio rerio ribosomal protein L9 (rpl9), transcript
            variant X1, mRNA.
ACCESSION   XM_005170906
VERSION     XM_005170906.5
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007112.7) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 8, 2024 this sequence version replaced XM_005170906.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000002035.6-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/15/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="1"
     gene            1..665
                     /gene="rpl9"
                     /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01;
                     zgc:103730"
                     /note="ribosomal protein L9; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     mRNAs, 66 ESTs, 1 Protein, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     156 samples with support for all annotated introns"
                     /db_xref="GeneID:336702"
                     /db_xref="ZFIN:ZDB-GENE-030131-8646"
     misc_feature    1
                     /gene="rpl9"
                     /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01;
                     zgc:103730"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             34..615
                     /gene="rpl9"
                     /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01;
                     zgc:103730"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL6 isoform X1"
                     /protein_id="XP_005170963.1"
                     /db_xref="GeneID:336702"
                     /db_xref="ZFIN:ZDB-GENE-030131-8646"
                     /translation="
MKTILSNQTVDIPDNVTVSLKGRTVTVKGPRGVLRREFNHINLELSLLGKKQKKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQESGSLVEIRNFLGEKYIRRVRMRQGVACAVSAAQKDELVLEGNDIELVSNSAALIQQATTVRKKDIRKFLDGIYVSEKGTVVEQQED"
     misc_feature    34..600
                     /gene="rpl9"
                     /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01;
                     zgc:103730"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
     polyA_site      665
                     /gene="rpl9"
                     /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01;
                     zgc:103730"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
cttcctccttcctttcccccttaatcggcgagaatgaagaccattctcagtaaccagacagtggacatccctgacaatgtcacggtgtccctcaagggccgcacagttaccgtgaagggaccccgtggtgttctccgccgggagttcaaccacattaacctggaactcagtctgttgggcaaaaaacagaaaaagctgcgtgtggataagtggtggggtaacagaaaggagttggccaccgtccgcaccatctgcagtcatgtccagaacatgatcaagggtgtcaccctgggcttcaggtacaaaatgcgatctgtatatgcccattttcccattaatgtggtcatccaagagtctggctctctggtggagatcagaaacttcttgggagagaagtacatccgccgtgtccgcatgaggcaaggagttgcatgtgcagtgtctgccgctcaaaaagacgagttggttctggagggtaatgatattgagctggtgtcaaactcagctgctctgatccagcaggccaccactgtgaggaagaaggacatccggaagttcctggatgggatttatgtcagcgagaagggcacagtggtggaacagcaagaggactaaattagtctctgtaaaatctgtcaataaagaccaactccatttttcaatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]