GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-14 03:40:45, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_212807               1493 bp    mRNA    linear   VRT 19-APR-2025
DEFINITION  Danio rerio POU class 4 homeobox 2 (pou4f2), mRNA.
ACCESSION   NM_212807
VERSION     NM_212807.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1493)
  AUTHORS   Shainer,I., Kuehn,E., Laurell,E., Al Kassar,M., Mokayes,N.,
            Sherman,S., Larsch,J., Kunst,M. and Baier,H.
  TITLE     A single-cell resolution gene expression atlas of the larval
            zebrafish brain
  JOURNAL   Sci Adv 9 (8), eade9909 (2023)
   PUBMED   36812331
REFERENCE   2  (bases 1 to 1493)
  AUTHORS   Huang,L., Liang,H., Wang,S. and Chen,S.
  TITLE     m6A writer complex promotes timely differentiation and survival of
            retinal progenitor cells in zebrafish
  JOURNAL   Biochem Biophys Res Commun 567, 171-176 (2021)
   PUBMED   34166914
REFERENCE   3  (bases 1 to 1493)
  AUTHORS   Postlethwait,J.H., Massaquoi,M.S., Farnsworth,D.R., Yan,Y.L.,
            Guillemin,K. and Miller,A.C.
  TITLE     The SARS-CoV-2 receptor and other key components of the
            Renin-Angiotensin-Aldosterone System related to COVID-19 are
            expressed in enterocytes in larval zebrafish
  JOURNAL   Biol Open 10 (3) (2021)
   PUBMED   33757938
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1493)
  AUTHORS   Postlethwait,J.H., Farnsworth,D.R. and Miller,A.C.
  TITLE     An intestinal cell type in zebrafish is the nexus for the
            SARS-CoV-2 receptor and the Renin-Angiotensin-Aldosterone System
            that contributes to COVID-19 comorbidities
  JOURNAL   bioRxiv (2020)
   PUBMED   32908984
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1493)
  AUTHORS   Zhao,G., Sun,H., Zhang,T. and Liu,J.X.
  TITLE     Copper induce zebrafish retinal developmental defects via
            triggering stresses and apoptosis
  JOURNAL   Cell Commun Signal 18 (1), 45 (2020)
   PUBMED   32169084
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1493)
  AUTHORS   Sherpa,T., Fimbel,S.M., Mallory,D.E., Maaswinkel,H., Spritzer,S.D.,
            Sand,J.A., Li,L., Hyde,D.R. and Stenkamp,D.L.
  TITLE     Ganglion cell regeneration following whole-retina destruction in
            zebrafish
  JOURNAL   Dev Neurobiol 68 (2), 166-181 (2008)
   PUBMED   18000816
REFERENCE   7  (bases 1 to 1493)
  AUTHORS   Rohrschneider,M.R., Elsen,G.E. and Prince,V.E.
  TITLE     Zebrafish Hoxb1a regulates multiple downstream genes including
            prickle1b
  JOURNAL   Dev Biol 309 (2), 358-372 (2007)
   PUBMED   17651720
REFERENCE   8  (bases 1 to 1493)
  AUTHORS   Xiao,T., Roeser,T., Staub,W. and Baier,H.
  TITLE     A GFP-based genetic screen reveals mutations that disrupt the
            architecture of the zebrafish retinotectal projection
  JOURNAL   Development 132 (13), 2955-2967 (2005)
   PUBMED   15930106
REFERENCE   9  (bases 1 to 1493)
  AUTHORS   Matsuda,N. and Mishina,M.
  TITLE     Identification of chaperonin CCT gamma subunit as a determinant of
            retinotectal development by whole-genome subtraction cloning from
            zebrafish no tectal neuron mutant
  JOURNAL   Development 131 (9), 1913-1925 (2004)
   PUBMED   15056614
REFERENCE   10 (bases 1 to 1493)
  AUTHORS   DeCarvalho,A.C., Cappendijk,S.L. and Fadool,J.M.
  TITLE     Developmental expression of the POU domain transcription factor
            Brn-3b (Pou4f2) in the lateral line and visual system of zebrafish
  JOURNAL   Dev Dyn 229 (4), 869-876 (2004)
   PUBMED   15042710
  REMARK    GeneRIF: The cloning and expression profile of brn-3b in the
            zebrafish (Danio rerio) were assessed as the first step for
            understanding its role in the development of sensory systems.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY196176.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY196176.1, BC162312.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1493
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="1"
     gene            1..1493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="POU class 4 homeobox 2"
                     /db_xref="GeneID:402816"
                     /db_xref="ZFIN:ZDB-GENE-040401-1"
     exon            1..493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    176..178
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="upstream in-frame stop codon"
     CDS             272..1426
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="brn3b; pou4f2/brn-3b"
                     /codon_start=1
                     /product="POU domain, class 4, transcription factor 2"
                     /protein_id="NP_997972.1"
                     /db_xref="GeneID:402816"
                     /db_xref="ZFIN:ZDB-GENE-040401-1"
                     /translation="
MMMMSLNSKQAFAMPHTSLAEPKYSSLHSSSSSSTLTSNAPSSSCSSSRHSSTISSSGGGSSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQTKSHHHPPHHSPFKPDATYHTMNTLPCTSSSSSSSVPISHPSALASHHHHHHHHHHQPHQALEGDLLDHITPGLALAGAMAGPDGSVVSTPAHPAHMAGMNHMHQAAINMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSACV"
     misc_feature    944..1177
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    1232..1402
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            494..1493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agtttaccgacaggttgcatggcttactggcgctcgcgacacgtctcaagccacggcacgcaacggagcgaccaacaagagcgcgttctttcagactaggcagcagcatcgctagatgagctatctagagacttggtgcatcatcctcttcacgtttgttgcaacgccagagacttgagacttccgagcagcgactggcttgaactccagtcgaagaagaaggcggagtcttaacttattaaaaggaactcgccgaagctcggtcgcaaatatgatgatgatgtctctgaacagcaagcaggcattcgccatgcctcacaccagtttggccgaacccaagtactccagcttgcattcctcgtcctcctcctctactctgacttccaacgcgccctcgtcctcctgctcctcgtccagacacagcagcacgatcagcagcagcggcggcggcagctcggaggcgatgcgccgagcatgtctcccaaccccaccgagcaatatattcggtggattggatgagagtttgttggcccgcgcggaagctctggcggcggtggatatagtctcgcagaccaaaagccatcatcacccacctcatcacagccccttcaagccggacgcaacctaccacaccatgaacacgcttccgtgcacctcctcgtcctcctcgtcgtccgtgcccatctcgcacccgtcagctctggcgagccatcaccaccaccaccaccatcaccatcaccagccgcaccaggcactggagggcgacctgctggaccacatcaccccgggactggccctcgccggagccatggccgggccagacggctcggtggtctccacgcctgcgcaccctgcccacatggcaggcatgaaccacatgcaccaagctgccatcaacatggctcacgcccatgggctgccatcccacatgggctgcatgagcgacgtggacgcagatcccagggacttggaggcattcgctgagcgctttaaacagcgtcggatcaaactcggcgtgacccaagcggatgtagggtcagcgctggccagcctgaagattcctggcgttggctctttaagccagagtaccatctgccggtttgagtcgctcacgttgtcccacaacaacatgatcgccctgaagcccatcctgcaagcctggctggaggaggcagaaaagtcgcaccgggagaaactcaacaaacccgagctcttcaacggggccgagaagaagaggaagcggacctccatcgcggcccctgagaaaaggtccctcgaagcgtactttgctattcagccgcgtccatcctcagaaaaaatcgcagcaatcgcagagaagctggacctcaaaaagaacgtagtgcgggtctggttttgcaaccagaggcagaaacaaaaacgcatgaaatactcggcctgcgtctagctcgagtagaagaccaacacaacgtgtcgagagactcctaaaactgtttaaagacgatttgtaaaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]