ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-09 08:46:26, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_212807 1493 bp mRNA linear VRT 19-APR-2025 DEFINITION Danio rerio POU class 4 homeobox 2 (pou4f2), mRNA. ACCESSION NM_212807 VERSION NM_212807.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1493) AUTHORS Shainer,I., Kuehn,E., Laurell,E., Al Kassar,M., Mokayes,N., Sherman,S., Larsch,J., Kunst,M. and Baier,H. TITLE A single-cell resolution gene expression atlas of the larval zebrafish brain JOURNAL Sci Adv 9 (8), eade9909 (2023) PUBMED 36812331 REFERENCE 2 (bases 1 to 1493) AUTHORS Huang,L., Liang,H., Wang,S. and Chen,S. TITLE m6A writer complex promotes timely differentiation and survival of retinal progenitor cells in zebrafish JOURNAL Biochem Biophys Res Commun 567, 171-176 (2021) PUBMED 34166914 REFERENCE 3 (bases 1 to 1493) AUTHORS Postlethwait,J.H., Massaquoi,M.S., Farnsworth,D.R., Yan,Y.L., Guillemin,K. and Miller,A.C. TITLE The SARS-CoV-2 receptor and other key components of the Renin-Angiotensin-Aldosterone System related to COVID-19 are expressed in enterocytes in larval zebrafish JOURNAL Biol Open 10 (3) (2021) PUBMED 33757938 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1493) AUTHORS Postlethwait,J.H., Farnsworth,D.R. and Miller,A.C. TITLE An intestinal cell type in zebrafish is the nexus for the SARS-CoV-2 receptor and the Renin-Angiotensin-Aldosterone System that contributes to COVID-19 comorbidities JOURNAL bioRxiv (2020) PUBMED 32908984 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1493) AUTHORS Zhao,G., Sun,H., Zhang,T. and Liu,J.X. TITLE Copper induce zebrafish retinal developmental defects via triggering stresses and apoptosis JOURNAL Cell Commun Signal 18 (1), 45 (2020) PUBMED 32169084 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1493) AUTHORS Sherpa,T., Fimbel,S.M., Mallory,D.E., Maaswinkel,H., Spritzer,S.D., Sand,J.A., Li,L., Hyde,D.R. and Stenkamp,D.L. TITLE Ganglion cell regeneration following whole-retina destruction in zebrafish JOURNAL Dev Neurobiol 68 (2), 166-181 (2008) PUBMED 18000816 REFERENCE 7 (bases 1 to 1493) AUTHORS Rohrschneider,M.R., Elsen,G.E. and Prince,V.E. TITLE Zebrafish Hoxb1a regulates multiple downstream genes including prickle1b JOURNAL Dev Biol 309 (2), 358-372 (2007) PUBMED 17651720 REFERENCE 8 (bases 1 to 1493) AUTHORS Xiao,T., Roeser,T., Staub,W. and Baier,H. TITLE A GFP-based genetic screen reveals mutations that disrupt the architecture of the zebrafish retinotectal projection JOURNAL Development 132 (13), 2955-2967 (2005) PUBMED 15930106 REFERENCE 9 (bases 1 to 1493) AUTHORS Matsuda,N. and Mishina,M. TITLE Identification of chaperonin CCT gamma subunit as a determinant of retinotectal development by whole-genome subtraction cloning from zebrafish no tectal neuron mutant JOURNAL Development 131 (9), 1913-1925 (2004) PUBMED 15056614 REFERENCE 10 (bases 1 to 1493) AUTHORS DeCarvalho,A.C., Cappendijk,S.L. and Fadool,J.M. TITLE Developmental expression of the POU domain transcription factor Brn-3b (Pou4f2) in the lateral line and visual system of zebrafish JOURNAL Dev Dyn 229 (4), 869-876 (2004) PUBMED 15042710 REMARK GeneRIF: The cloning and expression profile of brn-3b in the zebrafish (Danio rerio) were assessed as the first step for understanding its role in the development of sensory systems. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY196176.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY196176.1, BC162312.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1493 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="1" /map="1" gene 1..1493 /gene="pou4f2" /gene_synonym="brn-3b; brn3.2" /note="POU class 4 homeobox 2" /db_xref="GeneID:402816" /db_xref="ZFIN:ZDB-GENE-040401-1" exon 1..493 /gene="pou4f2" /gene_synonym="brn-3b; brn3.2" /inference="alignment:Splign:2.1.0" misc_feature 176..178 /gene="pou4f2" /gene_synonym="brn-3b; brn3.2" /note="upstream in-frame stop codon" CDS 272..1426 /gene="pou4f2" /gene_synonym="brn-3b; brn3.2" /note="brn3b; pou4f2/brn-3b" /codon_start=1 /product="POU domain, class 4, transcription factor 2" /protein_id="NP_997972.1" /db_xref="GeneID:402816" /db_xref="ZFIN:ZDB-GENE-040401-1" /translation="
MMMMSLNSKQAFAMPHTSLAEPKYSSLHSSSSSSTLTSNAPSSSCSSSRHSSTISSSGGGSSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQTKSHHHPPHHSPFKPDATYHTMNTLPCTSSSSSSSVPISHPSALASHHHHHHHHHHQPHQALEGDLLDHITPGLALAGAMAGPDGSVVSTPAHPAHMAGMNHMHQAAINMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSACV"
misc_feature 944..1177
/gene="pou4f2"
/gene_synonym="brn-3b; brn3.2"
/note="Found in Pit-Oct-Unc transcription factors; Region:
POU; smart00352"
/db_xref="CDD:197673"
misc_feature 1232..1402
/gene="pou4f2"
/gene_synonym="brn-3b; brn3.2"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 494..1493
/gene="pou4f2"
/gene_synonym="brn-3b; brn3.2"
/inference="alignment:Splign:2.1.0"
ORIGIN
agtttaccgacaggttgcatggcttactggcgctcgcgacacgtctcaagccacggcacgcaacggagcgaccaacaagagcgcgttctttcagactaggcagcagcatcgctagatgagctatctagagacttggtgcatcatcctcttcacgtttgttgcaacgccagagacttgagacttccgagcagcgactggcttgaactccagtcgaagaagaaggcggagtcttaacttattaaaaggaactcgccgaagctcggtcgcaaatatgatgatgatgtctctgaacagcaagcaggcattcgccatgcctcacaccagtttggccgaacccaagtactccagcttgcattcctcgtcctcctcctctactctgacttccaacgcgccctcgtcctcctgctcctcgtccagacacagcagcacgatcagcagcagcggcggcggcagctcggaggcgatgcgccgagcatgtctcccaaccccaccgagcaatatattcggtggattggatgagagtttgttggcccgcgcggaagctctggcggcggtggatatagtctcgcagaccaaaagccatcatcacccacctcatcacagccccttcaagccggacgcaacctaccacaccatgaacacgcttccgtgcacctcctcgtcctcctcgtcgtccgtgcccatctcgcacccgtcagctctggcgagccatcaccaccaccaccaccatcaccatcaccagccgcaccaggcactggagggcgacctgctggaccacatcaccccgggactggccctcgccggagccatggccgggccagacggctcggtggtctccacgcctgcgcaccctgcccacatggcaggcatgaaccacatgcaccaagctgccatcaacatggctcacgcccatgggctgccatcccacatgggctgcatgagcgacgtggacgcagatcccagggacttggaggcattcgctgagcgctttaaacagcgtcggatcaaactcggcgtgacccaagcggatgtagggtcagcgctggccagcctgaagattcctggcgttggctctttaagccagagtaccatctgccggtttgagtcgctcacgttgtcccacaacaacatgatcgccctgaagcccatcctgcaagcctggctggaggaggcagaaaagtcgcaccgggagaaactcaacaaacccgagctcttcaacggggccgagaagaagaggaagcggacctccatcgcggcccctgagaaaaggtccctcgaagcgtactttgctattcagccgcgtccatcctcagaaaaaatcgcagcaatcgcagagaagctggacctcaaaaagaacgtagtgcgggtctggttttgcaaccagaggcagaaacaaaaacgcatgaaatactcggcctgcgtctagctcgagtagaagaccaacacaacgtgtcgagagactcctaaaactgtttaaagacgatttgtaaaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]