LOCUS       NM_212807               1493 bp    mRNA    linear   VRT 16-APR-2022
DEFINITION  Danio rerio POU class 4 homeobox 2 (pou4f2), mRNA.
ACCESSION   NM_212807
VERSION     NM_212807.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1493)
  AUTHORS   Huang L, Liang H, Wang S and Chen S.
  TITLE     m(6)A writer complex promotes timely differentiation and survival
            of retinal progenitor cells in zebrafish
  JOURNAL   Biochem Biophys Res Commun 567, 171-176 (2021)
   PUBMED   34166914
REFERENCE   2  (bases 1 to 1493)
  AUTHORS   Postlethwait JH, Massaquoi MS, Farnsworth DR, Yan YL, Guillemin K
            and Miller AC.
  TITLE     The SARS-CoV-2 receptor and other key components of the
            Renin-Angiotensin-Aldosterone System related to COVID-19 are
            expressed in enterocytes in larval zebrafish
  JOURNAL   Biol Open 10 (3) (2021)
   PUBMED   33757938
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1493)
  AUTHORS   Postlethwait,J.H., Farnsworth,D.R. and Miller,A.C.
  TITLE     An intestinal cell type in zebrafish is the nexus for the
            SARS-CoV-2 receptor and the Renin-Angiotensin-Aldosterone System
            that contributes to COVID-19 comorbidities
  JOURNAL   bioRxiv (2020)
   PUBMED   32908984
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1493)
  AUTHORS   Zhao G, Sun H, Zhang T and Liu JX.
  TITLE     Copper induce zebrafish retinal developmental defects via
            triggering stresses and apoptosis
  JOURNAL   Cell Commun Signal 18 (1), 45 (2020)
   PUBMED   32169084
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1493)
  AUTHORS   Umali J, Hawkey-Noble A and French CR.
  TITLE     Loss of foxc1 in zebrafish reduces optic nerve size and cell number
            in the retinal ganglion cell layer
  JOURNAL   Vision Res 156, 66-72 (2019)
   PUBMED   30684501
REFERENCE   6  (bases 1 to 1493)
  AUTHORS   Sherpa T, Fimbel SM, Mallory DE, Maaswinkel H, Spritzer SD, Sand
            JA, Li L, Hyde DR and Stenkamp DL.
  TITLE     Ganglion cell regeneration following whole-retina destruction in
            zebrafish
  JOURNAL   Dev Neurobiol 68 (2), 166-181 (2008)
   PUBMED   18000816
REFERENCE   7  (bases 1 to 1493)
  AUTHORS   Rohrschneider MR, Elsen GE and Prince VE.
  TITLE     Zebrafish Hoxb1a regulates multiple downstream genes including
            prickle1b
  JOURNAL   Dev Biol 309 (2), 358-372 (2007)
   PUBMED   17651720
REFERENCE   8  (bases 1 to 1493)
  AUTHORS   Xiao T, Roeser T, Staub W and Baier H.
  TITLE     A GFP-based genetic screen reveals mutations that disrupt the
            architecture of the zebrafish retinotectal projection
  JOURNAL   Development 132 (13), 2955-2967 (2005)
   PUBMED   15930106
REFERENCE   9  (bases 1 to 1493)
  AUTHORS   Matsuda N and Mishina M.
  TITLE     Identification of chaperonin CCT gamma subunit as a determinant of
            retinotectal development by whole-genome subtraction cloning from
            zebrafish no tectal neuron mutant
  JOURNAL   Development 131 (9), 1913-1925 (2004)
   PUBMED   15056614
REFERENCE   10 (bases 1 to 1493)
  AUTHORS   DeCarvalho AC, Cappendijk SL and Fadool JM.
  TITLE     Developmental expression of the POU domain transcription factor
            Brn-3b (Pou4f2) in the lateral line and visual system of zebrafish
  JOURNAL   Dev Dyn 229 (4), 869-876 (2004)
   PUBMED   15042710
  REMARK    GeneRIF: The cloning and expression profile of brn-3b in the
            zebrafish (Danio rerio) were assessed as the first step for
            understanding its role in the development of sensory systems.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY196176.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY196176.1, BC162312.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1493
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="1"
     gene            1..1493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="POU class 4 homeobox 2"
                     /db_xref="GeneID:402816"
                     /db_xref="ZFIN:ZDB-GENE-040401-1"
     exon            1..493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    176..178
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="upstream in-frame stop codon"
     CDS             272..1426
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="brn3b; pou4f2/brn-3b"
                     /codon_start=1
                     /product="POU domain, class 4, transcription factor 2"
                     /protein_id="NP_997972.1"
                     /db_xref="GeneID:402816"
                     /db_xref="ZFIN:ZDB-GENE-040401-1"
                     /translation="

MMMMSLNSKQAFAMPHTSLAEPKYSSLHSSSSSSTLTSNAPSSSCSSSRHSSTISSSGGGSSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQTKSHHHPPHHSPFKPDATYHTMNTLPCTSSSSSSSVPISHPSALASHHHHHHHHHHQPHQALEGDLLDHITPGLALAGAMAGPDGSVVSTPAHPAHMAGMNHMHQAAINMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSACV"

     misc_feature    944..1177
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    1232..1402
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            494..1493
                     /gene="pou4f2"
                     /gene_synonym="brn-3b; brn3.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agtttaccgacaggttgcatggcttactggcgctcgcgacacgtctcaagccacggcacgcaacggagcgaccaacaagagcgcgttctttcagactaggcagcagcatcgctagatgagctatctagagacttggtgcatcatcctcttcacgtttgttgcaacgccagagacttgagacttccgagcagcgactggcttgaactccagtcgaagaagaaggcggagtcttaacttattaaaaggaactcgccgaagctcggtcgcaaatatgatgatgatgtctctgaacagcaagcaggcattcgccatgcctcacaccagtttggccgaacccaagtactccagcttgcattcctcgtcctcctcctctactctgacttccaacgcgccctcgtcctcctgctcctcgtccagacacagcagcacgatcagcagcagcggcggcggcagctcggaggcgatgcgccgagcatgtctcccaaccccaccgagcaatatattcggtggattggatgagagtttgttggcccgcgcggaagctctggcggcggtggatatagtctcgcagaccaaaagccatcatcacccacctcatcacagccccttcaagccggacgcaacctaccacaccatgaacacgcttccgtgcacctcctcgtcctcctcgtcgtccgtgcccatctcgcacccgtcagctctggcgagccatcaccaccaccaccaccatcaccatcaccagccgcaccaggcactggagggcgacctgctggaccacatcaccccgggactggccctcgccggagccatggccgggccagacggctcggtggtctccacgcctgcgcaccctgcccacatggcaggcatgaaccacatgcaccaagctgccatcaacatggctcacgcccatgggctgccatcccacatgggctgcatgagcgacgtggacgcagatcccagggacttggaggcattcgctgagcgctttaaacagcgtcggatcaaactcggcgtgacccaagcggatgtagggtcagcgctggccagcctgaagattcctggcgttggctctttaagccagagtaccatctgccggtttgagtcgctcacgttgtcccacaacaacatgatcgccctgaagcccatcctgcaagcctggctggaggaggcagaaaagtcgcaccgggagaaactcaacaaacccgagctcttcaacggggccgagaagaagaggaagcggacctccatcgcggcccctgagaaaaggtccctcgaagcgtactttgctattcagccgcgtccatcctcagaaaaaatcgcagcaatcgcagagaagctggacctcaaaaagaacgtagtgcgggtctggttttgcaaccagaggcagaaacaaaaacgcatgaaatactcggcctgcgtctagctcgagtagaagaccaacacaacgtgtcgagagactcctaaaactgtttaaagacgatttgtaaaat

//