2025-09-13 19:50:54, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_205690 1382 bp mRNA linear VRT 16-SEP-2024 DEFINITION Danio rerio retinaldehyde binding protein 1b (rlbp1b), mRNA. ACCESSION NM_205690 VERSION NM_205690.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1382) AUTHORS Ulhaq,Z.S., Okamoto,K., Ogino,Y. and Tse,W.K.F. TITLE Dysregulation of Spliceosomes Complex Induces Retinitis Pigmentosa-Like Characteristics in sf3b4-Depleted Zebrafish JOURNAL Am J Pathol 193 (9), 1223-1233 (2023) PUBMED 37263342 REFERENCE 2 (bases 1 to 1382) AUTHORS Chen,D.D., Liu,B., Wang,Y., Jiang,M., Shang,G., Xue,M., Jia,X., Lang,Y., Zhou,G., Zhang,F., Peng,X. and Hu,Y. TITLE The downregulation of HSP90-controlled CRALBP expression is associated with age-related vision attenuation JOURNAL FASEB J 37 (3), e22832 (2023) PUBMED 36826429 REFERENCE 3 (bases 1 to 1382) AUTHORS Schlegel,D.K., Ramkumar,S., von Lintig,J. and Neuhauss,S.C. TITLE Disturbed retinoid metabolism upon loss of rlbp1a impairs cone function and leads to subretinal lipid deposits and photoreceptor degeneration in the zebrafish retina JOURNAL Elife 10, e71473 (2021) PUBMED 34668483 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1382) AUTHORS Ward,R., Kaylor,J.J., Cobice,D.F., Pepe,D.A., McGarrigle,E.M., Brockerhoff,S.E., Hurley,J.B., Travis,G.H. and Kennedy,B.N. TITLE Non-photopic and photopic visual cycles differentially regulate immediate, early, and late phases of cone photoreceptor-mediated vision JOURNAL J Biol Chem 295 (19), 6482-6497 (2020) PUBMED 32238432 REFERENCE 5 (bases 1 to 1382) AUTHORS Ranski,A.H., Kramer,A.C., Morgan,G.W., Perez,J.L. and Thummel,R. TITLE Characterization of retinal regeneration in adult zebrafish following multiple rounds of phototoxic lesion JOURNAL PeerJ 6, e5646 (2018) PUBMED 30258730 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1382) AUTHORS Thomas,J.L., Ranski,A.H., Morgan,G.W. and Thummel,R. TITLE Reactive gliosis in the adult zebrafish retina JOURNAL Exp Eye Res 143, 98-109 (2016) PUBMED 26492821 REFERENCE 7 (bases 1 to 1382) AUTHORS Konzer,A., Ruhs,A., Braun,H., Jungblut,B., Braun,T. and Kruger,M. TITLE Stable isotope labeling in zebrafish allows in vivo monitoring of cardiac morphogenesis JOURNAL Mol Cell Proteomics 12 (6), 1502-1512 (2013) PUBMED 23412571 REFERENCE 8 (bases 1 to 1382) AUTHORS Veneman,W.J., Stockhammer,O.W., de Boer,L., Zaat,S.A., Meijer,A.H. and Spaink,H.P. TITLE A zebrafish high throughput screening system used for Staphylococcus epidermidis infection marker discovery JOURNAL BMC Genomics 14, 255 (2013) PUBMED 23586901 REMARK Publication Status: Online-Only REFERENCE 9 (bases 1 to 1382) AUTHORS Collery,R., McLoughlin,S., Vendrell,V., Finnegan,J., Crabb,J.W., Saari,J.C. and Kennedy,B.N. TITLE Duplication and divergence of zebrafish CRALBP genes uncovers novel role for RPE- and Muller-CRALBP in cone vision JOURNAL Invest Ophthalmol Vis Sci 49 (9), 3812-3820 (2008) PUBMED 18502992 REFERENCE 10 (bases 1 to 1382) AUTHORS Fleisch,V.C., Schonthaler,H.B., von Lintig,J. and Neuhauss,S.C. TITLE Subfunctionalization of a retinoid-binding protein provides evidence for two parallel visual cycles in the cone-dominant zebrafish retina JOURNAL J Neurosci 28 (33), 8208-8216 (2008) PUBMED 18701683 REMARK GeneRIF: Cralbp b expression in Muller cells of the retina is essential for cone vision and provides evidence that both the canonical and the alternative visual cycle depend on the same type of retinoid-binding protein. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC065863.1. On Aug 30, 2012 this sequence version replaced NM_205690.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC065863.1, EU348854.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1382 BC065863.1 5-1386 FEATURES Location/Qualifiers source 1..1382 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="25" /map="25" gene 1..1382 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /note="retinaldehyde binding protein 1b" /db_xref="GeneID:402990" /db_xref="ZFIN:ZDB-GENE-040426-1870" exon 1..42 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" misc_feature 16..18 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /note="upstream in-frame stop codon" CDS 31..954 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /note="cralbpa; rlbp1a; retinaldehyde binding protein 1" /codon_start=1 /product="retinaldehyde-binding protein 1b" /protein_id="NP_991253.1" /db_xref="GeneID:402990" /db_xref="ZFIN:ZDB-GENE-040426-1870" /translation="
MAVVSGTFRMVSEEEQALRAKLEHLTVKDHGPVFEASTKVPDHTMQKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFRRDYPELFENLTPEAVRSTIEAGYPGILSSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDGKGSKYDGKITAAHLFD"
misc_feature 208..381 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /note="CRAL/TRIO, N-terminal domain; Region: CRAL_TRIO_N; smart01100" /db_xref="CDD:215024" misc_feature 451..906 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /note="Sec14p-like lipid-binding domain; Region: SEC14; cd00170" /db_xref="CDD:469559" exon 43..171 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" exon 172..376 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" exon 377..555 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" exon 556..714 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" exon 715..825 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" exon 826..1356 /gene="rlbp1b" /gene_synonym="CRALBPb; rlbp1; zgc:77766" /inference="alignment:Splign:2.1.0" ORIGIN
cacagaacgttgcattgagtatttgaagcaatggcggttgttagtggaacatttcgaatggtgtccgaggaggagcaggcccttcgggcgaagctggagcacctcacggtcaaagaccatgggcccgtgtttgaagcctctacaaaagtaccagaccacaccatgcagaaggctaaagatgagctgaatgagacggatgagaagcgaacgtcagctgtgaaggagctcagaggaataatcaaggagaaggcagagactggagatgagcttgctaaaggtgttcaggatacttttggggaaaaacccgatggcgtgcttgtgaggttcatccgtgccaggaaatatgatgtaaaccgggcctatgaactcatgaagggttatgtgcgcttcagacgggattatcctgaactttttgaaaacttgactccggaggctgtgcgcagcaccattgaggccggatacccaggaatcctatccagcagagacaaatatggccgcgtggtgctactctttaacatcgagaactgggactatgaggagatcacttttgatgagatccttagagcttactgtgtgatcctggagaagcttctggaaaatgaggagactcagatcaacggcttttgcatcatcgagaactttaagggtttcacaatgcagcaagcctccggcatcaagcccacagagctaaagaaaatggtggacatgttgcaggactctttccctgcccgtttcaaagcagtgcactttatccaccagccctggtacttcaccaccacatacaatgtggtcaaacccctgatgaagagcaaactgctggaaagggtgtttgtccacggtgatgacctggaaaactacttcaaggagtttgatgctgaaatcctgccatcagactttgatggtaaaggctccaaatatgacggcaagatcacagcagcacatctgtttgactaggccattttcagcctgtcactgtacaagaacacgactgtcgttttagttgcattgtatcacatggcattccaatgtgtttattttcctgagggtgaacccagaagtatagagattttcccaagcgaaactggataagtctccagacgccatcaaagagggatgaaaacagatacgatcagttagttctctatgagggccgtgtatttagattttccctgaaatatagatattcttcagcaacagatggcagatgacaaagtccaggcattcctgttctttgtctttttaactgagaacggaaaagcactcagcctggtctaagtgttacaagcaaactatatatgatgttcagaatgtgtagaatgtttctgtttctctaaataaagtgcacatttcaaatgaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]