GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-20 17:41:52, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_200770               1473 bp    mRNA    linear   VRT 02-APR-2025
DEFINITION  Danio rerio fascin actin-bundling protein 2b, retinal (fscn2b),
            mRNA.
ACCESSION   NM_200770
VERSION     NM_200770.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1473)
  AUTHORS   Zhu,S., Chen,Z., Wang,H. and McDermott,B.M. Jr.
  TITLE     Tmc Reliance Is Biased by the Hair Cell Subtype and Position Within
            the Ear
  JOURNAL   Front Cell Dev Biol 8, 570486 (2021)
   PUBMED   33490059
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1473)
  AUTHORS   Pollock,L.M., Gupta,N., Chen,X., Luna,E.J. and McDermott,B.M. Jr.
  TITLE     Supervillin Is a Component of the Hair Cell's Cuticular Plate and
            the Head Plates of Organ of Corti Supporting Cells
  JOURNAL   PLoS One 11 (7), e0158349 (2016)
   PUBMED   27415442
  REMARK    Erratum:[PLoS One. 2016 Aug 17;11(8):e0161638. doi:
            10.1371/journal.pone.0161638. PMID: 27532603]
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1473)
  AUTHORS   Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D.,
            Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H.,
            Guiguen,Y. and Bobe,J.
  TITLE     Gene evolution and gene expression after whole genome duplication
            in fish: the PhyloFish database
  JOURNAL   BMC Genomics 17, 368 (2016)
   PUBMED   27189481
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1473)
  AUTHORS   Hwang,P., Chou,S.W., Chen,Z. and McDermott,B.M. Jr.
  TITLE     The Stereociliary Paracrystal Is a Dynamic Cytoskeletal Scaffold In
            Vivo
  JOURNAL   Cell Rep 13 (7), 1287-1294 (2015)
   PUBMED   26549442
REFERENCE   5  (bases 1 to 1473)
  AUTHORS   Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S.,
            Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M.,
            Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y.,
            Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B.,
            Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1473)
  AUTHORS   Gopal,S.R., Chen,D.H., Chou,S.W., Zang,J., Neuhauss,S.C.,
            Stepanyan,R., McDermott,B.M. Jr. and Alagramam,K.N.
  TITLE     Zebrafish Models for the Mechanosensory Hair Cell Dysfunction in
            Usher Syndrome 3 Reveal That Clarin-1 Is an Essential Hair Bundle
            Protein
  JOURNAL   J Neurosci 35 (28), 10188-10201 (2015)
   PUBMED   26180195
REFERENCE   7  (bases 1 to 1473)
  AUTHORS   Boer,E.F., Howell,E.D., Schilling,T.F., Jette,C.A. and Stewart,R.A.
  TITLE     Fascin1-dependent Filopodia are required for directional migration
            of a subset of neural crest cells
  JOURNAL   PLoS Genet 11 (1), e1004946 (2015)
   PUBMED   25607881
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 1473)
  AUTHORS   O'Quin,K.E., Yoshizawa,M., Doshi,P. and Jeffery,W.R.
  TITLE     Quantitative genetic analysis of retinal degeneration in the blind
            cavefish Astyanax mexicanus
  JOURNAL   PLoS One 8 (2), e57281 (2013)
   PUBMED   23437360
REFERENCE   9  (bases 1 to 1473)
  AUTHORS   Chou,S.W., Hwang,P., Gomez,G., Fernando,C.A., West,M.C.,
            Pollock,L.M., Lin-Jones,J., Burnside,B. and McDermott,B.M. Jr.
  TITLE     Fascin 2b is a component of stereocilia that lengthens actin-based
            protrusions
  JOURNAL   PLoS One 6 (4), e14807 (2011)
   PUBMED   21625653
  REMARK    GeneRIF: fascin 2b plays a key role in shaping stereocilia
REFERENCE   10 (bases 1 to 1473)
  AUTHORS   Lin-Jones,J. and Burnside,B.
  TITLE     Retina-specific protein fascin 2 is an actin cross-linker
            associated with actin bundles in photoreceptor inner segments and
            calycal processes
  JOURNAL   Invest Ophthalmol Vis Sci 48 (3), 1380-1388 (2007)
   PUBMED   17325187
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from EU580143.1.
            
            On Apr 21, 2008 this sequence version replaced NM_200770.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: EU580143.1, EE203503.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505374,
                                           SAMEA3505384 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1473
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="12"
                     /map="12"
     gene            1..1473
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="fascin actin-bundling protein 2b, retinal"
                     /db_xref="GeneID:393743"
                     /db_xref="ZFIN:ZDB-GENE-040426-1740"
     CDS             1..1473
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="fascin 2B; fascin homolog 1-like, actin-bundling
                     protein; fascin homolog 2, actin-bundling protein, retinal
                     b"
                     /codon_start=1
                     /product="fascin-2b"
                     /protein_id="NP_957064.2"
                     /db_xref="GeneID:393743"
                     /db_xref="ZFIN:ZDB-GENE-040426-1740"
                     /translation="
MPSNGTKALKLQFGLINHENRYLTAEAFGFKVNASAPSLKKKQIWTLEQDDQDGQVVYLRSHLGRYLASDKDGKVSCEAETKENDCRFLIVAQSDGRWALQSETYLRFFGGSEDYLSCFAQTIGEAELWAMHLALHPQANLLSVARKRYAHLASPEGEIAVDCNIPWGVDALLTLVYMDGKYCLKTSDSRFLSNDGKLSSENGRGTGYTLELKSGKLAFKDCEGKYLTPMGPTGTLRSGRCSKPGKDELFDLEESHPQVVFQAANNRFVSIRQGVSVSANQDDETDMETFQMEIDKDTRKCKFRTNEGNYWTLVAHGGIQSTATEAGANTMFDIVWLGRRVALRASNGKYVCTKKNGQLSAVSDSVGEDEQLILKLINRPILILRGENGYVCHHKNSNTLDASRSVYDIFTLQFSDGAYHIKGAGGKFWYVSSSGXVCSDGDTPEDFSFEFLEHGRIAIRGKNGKYLRGDQGGNLKGDGETADSSSLWEY"
     misc_feature    16..405
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="first fascin-like domain, beta-trefoil fold, found
                     in fascin-2 and similar proteins; Region:
                     beta-trefoil_FSCN2_rpt1; cd23345"
                     /db_xref="CDD:467453"
     misc_feature    order(28..30,37..39,43..45,139..141,145..147,169..171,
                     175..177,268..270,292..294,298..300,391..393)
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:467453"
     misc_feature    order(115..123,130..132,400..402)
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="putative actin-binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:467453"
     misc_feature    406..762
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="fascin-like domain, beta-trefoil fold, found in the
                     fascin-like family; Region: beta-trefoil_FSCN-like;
                     cl49611"
                     /db_xref="CDD:483951"
     misc_feature    766..1134
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="third fascin-like domain, beta-trefoil fold, found
                     in fascin-2 and similar proteins; Region:
                     beta-trefoil_FSCN2_rpt3; cd23353"
                     /db_xref="CDD:467461"
     misc_feature    order(1012..1014,1120..1134)
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="putative actin-binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:467461"
     misc_feature    1135..1470
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="fourth fascin-like domain, beta-trefoil fold, found
                     in fascin-2 and similar proteins; Region:
                     beta-trefoil_FSCN2_rpt4; cd23357"
                     /db_xref="CDD:467465"
     misc_feature    order(1135..1140,1234..1236,1240..1242,1249..1251,
                     1255..1257,1342..1347)
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="putative actin-binding site 2 [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467465"
     misc_feature    1153..1167
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /note="putative actin-binding site 1 [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467465"
     exon            1..820
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /inference="alignment:Splign:2.1.0"
     exon            821..977
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /inference="alignment:Splign:2.1.0"
     exon            978..1099
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /inference="alignment:Splign:2.1.0"
     exon            1100..1267
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /inference="alignment:Splign:2.1.0"
     exon            1268..1473
                     /gene="fscn2b"
                     /gene_synonym="fscn1l; fscn2; zgc:73272"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgccctccaatggcaccaaagcccttaagcttcaattcgggcttattaatcatgagaatcgctacctaacggcggaggccttcggcttcaaggtgaacgcttcagctccaagcctcaagaagaagcagatctggactctagagcaagacgatcaggatggtcaggtggtttaccttcgtagtcacctagggcgctacctggcctctgacaaagatggcaaggtaagctgtgaggctgagactaaagagaatgactgtcgctttttgattgtggcacagtcagatggccgctgggccctgcagtctgagacatatttgcgctttttcggaggttcagaagactacttgtcgtgctttgctcagacaataggtgaggcagaactatgggccatgcatctagccctacacccacaagctaatctgcttagtgtggcccgcaaacgatatgcccacttggcatcgccagagggagagattgctgtagactgcaacatcccatggggtgttgatgcacttctaactcttgtgtacatggacggcaaatattgtcttaagaccagtgacagccgcttccttagcaatgatgggaaactgtcctctgaaaatggacgtggcacaggctacaccttggaactgaaatcaggcaaattggccttcaaggactgtgaggggaagtacttgacccccatggggcccactggaactctgcgctctggacgatgctccaaacctggcaaagatgagctgtttgatcttgaggaaagccatccgcaagtggtgtttcaggccgccaacaacagatttgtctccattcgacagggtgtgagcgtctcagccaatcaggacgatgagacagacatggagacgtttcaaatggaaattgataaagatacgagaaagtgcaaattcagaaccaatgaaggaaattattggacgctcgtcgctcatgggggcatccagtcaacagccacagaagccggtgccaacaccatgtttgacatcgtgtggctcggtcgacgggtggcactgcgggccagcaatggaaaatatgtatgtactaagaaaaacggccagctttctgcagtcagcgactctgtgggcgaggacgagcagctgattctgaagctgatcaacaggcccattctgatcctgaggggagaaaacggctatgtttgccaccacaaaaactcaaacacgctggacgccagtcgctcggtttatgacattttcacactgcagttcagtgatggtgcataccatattaaaggtgctggcgggaaattctggtatgtgtccagcagtggttwggtgtgttcagacggagacacgcctgaggatttcagctttgagttcttagagcacggacgaatagcgattagaggcaaaaacggcaaatacctgcggggagatcagggcgggaatctgaaaggagacggagagacggcggacagctcttccctctgggaatactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]