2025-10-20 17:41:52, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_200770 1473 bp mRNA linear VRT 02-APR-2025 DEFINITION Danio rerio fascin actin-bundling protein 2b, retinal (fscn2b), mRNA. ACCESSION NM_200770 VERSION NM_200770.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1473) AUTHORS Zhu,S., Chen,Z., Wang,H. and McDermott,B.M. Jr. TITLE Tmc Reliance Is Biased by the Hair Cell Subtype and Position Within the Ear JOURNAL Front Cell Dev Biol 8, 570486 (2021) PUBMED 33490059 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1473) AUTHORS Pollock,L.M., Gupta,N., Chen,X., Luna,E.J. and McDermott,B.M. Jr. TITLE Supervillin Is a Component of the Hair Cell's Cuticular Plate and the Head Plates of Organ of Corti Supporting Cells JOURNAL PLoS One 11 (7), e0158349 (2016) PUBMED 27415442 REMARK Erratum:[PLoS One. 2016 Aug 17;11(8):e0161638. doi: 10.1371/journal.pone.0161638. PMID: 27532603] Publication Status: Online-Only REFERENCE 3 (bases 1 to 1473) AUTHORS Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D., Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H., Guiguen,Y. and Bobe,J. TITLE Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database JOURNAL BMC Genomics 17, 368 (2016) PUBMED 27189481 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1473) AUTHORS Hwang,P., Chou,S.W., Chen,Z. and McDermott,B.M. Jr. TITLE The Stereociliary Paracrystal Is a Dynamic Cytoskeletal Scaffold In Vivo JOURNAL Cell Rep 13 (7), 1287-1294 (2015) PUBMED 26549442 REFERENCE 5 (bases 1 to 1473) AUTHORS Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S., Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M., Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y., Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B., Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R. TITLE RFX transcription factors are essential for hearing in mice JOURNAL Nat Commun 6, 8549 (2015) PUBMED 26469318 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1473) AUTHORS Gopal,S.R., Chen,D.H., Chou,S.W., Zang,J., Neuhauss,S.C., Stepanyan,R., McDermott,B.M. Jr. and Alagramam,K.N. TITLE Zebrafish Models for the Mechanosensory Hair Cell Dysfunction in Usher Syndrome 3 Reveal That Clarin-1 Is an Essential Hair Bundle Protein JOURNAL J Neurosci 35 (28), 10188-10201 (2015) PUBMED 26180195 REFERENCE 7 (bases 1 to 1473) AUTHORS Boer,E.F., Howell,E.D., Schilling,T.F., Jette,C.A. and Stewart,R.A. TITLE Fascin1-dependent Filopodia are required for directional migration of a subset of neural crest cells JOURNAL PLoS Genet 11 (1), e1004946 (2015) PUBMED 25607881 REMARK Publication Status: Online-Only REFERENCE 8 (bases 1 to 1473) AUTHORS O'Quin,K.E., Yoshizawa,M., Doshi,P. and Jeffery,W.R. TITLE Quantitative genetic analysis of retinal degeneration in the blind cavefish Astyanax mexicanus JOURNAL PLoS One 8 (2), e57281 (2013) PUBMED 23437360 REFERENCE 9 (bases 1 to 1473) AUTHORS Chou,S.W., Hwang,P., Gomez,G., Fernando,C.A., West,M.C., Pollock,L.M., Lin-Jones,J., Burnside,B. and McDermott,B.M. Jr. TITLE Fascin 2b is a component of stereocilia that lengthens actin-based protrusions JOURNAL PLoS One 6 (4), e14807 (2011) PUBMED 21625653 REMARK GeneRIF: fascin 2b plays a key role in shaping stereocilia REFERENCE 10 (bases 1 to 1473) AUTHORS Lin-Jones,J. and Burnside,B. TITLE Retina-specific protein fascin 2 is an actin cross-linker associated with actin bundles in photoreceptor inner segments and calycal processes JOURNAL Invest Ophthalmol Vis Sci 48 (3), 1380-1388 (2007) PUBMED 17325187 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from EU580143.1. On Apr 21, 2008 this sequence version replaced NM_200770.1. ##Evidence-Data-START## Transcript exon combination :: EU580143.1, EE203503.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505374, SAMEA3505384 [ECO:0006172] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1473 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="12" /map="12" gene 1..1473 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="fascin actin-bundling protein 2b, retinal" /db_xref="GeneID:393743" /db_xref="ZFIN:ZDB-GENE-040426-1740" CDS 1..1473 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="fascin 2B; fascin homolog 1-like, actin-bundling protein; fascin homolog 2, actin-bundling protein, retinal b" /codon_start=1 /product="fascin-2b" /protein_id="NP_957064.2" /db_xref="GeneID:393743" /db_xref="ZFIN:ZDB-GENE-040426-1740" /translation="
MPSNGTKALKLQFGLINHENRYLTAEAFGFKVNASAPSLKKKQIWTLEQDDQDGQVVYLRSHLGRYLASDKDGKVSCEAETKENDCRFLIVAQSDGRWALQSETYLRFFGGSEDYLSCFAQTIGEAELWAMHLALHPQANLLSVARKRYAHLASPEGEIAVDCNIPWGVDALLTLVYMDGKYCLKTSDSRFLSNDGKLSSENGRGTGYTLELKSGKLAFKDCEGKYLTPMGPTGTLRSGRCSKPGKDELFDLEESHPQVVFQAANNRFVSIRQGVSVSANQDDETDMETFQMEIDKDTRKCKFRTNEGNYWTLVAHGGIQSTATEAGANTMFDIVWLGRRVALRASNGKYVCTKKNGQLSAVSDSVGEDEQLILKLINRPILILRGENGYVCHHKNSNTLDASRSVYDIFTLQFSDGAYHIKGAGGKFWYVSSSGXVCSDGDTPEDFSFEFLEHGRIAIRGKNGKYLRGDQGGNLKGDGETADSSSLWEY"
misc_feature 16..405 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="first fascin-like domain, beta-trefoil fold, found in fascin-2 and similar proteins; Region: beta-trefoil_FSCN2_rpt1; cd23345" /db_xref="CDD:467453" misc_feature order(28..30,37..39,43..45,139..141,145..147,169..171, 175..177,268..270,292..294,298..300,391..393) /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="putative ligand binding site [chemical binding]; other site" /db_xref="CDD:467453" misc_feature order(115..123,130..132,400..402) /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="putative actin-binding site [polypeptide binding]; other site" /db_xref="CDD:467453" misc_feature 406..762 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="fascin-like domain, beta-trefoil fold, found in the fascin-like family; Region: beta-trefoil_FSCN-like; cl49611" /db_xref="CDD:483951" misc_feature 766..1134 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="third fascin-like domain, beta-trefoil fold, found in fascin-2 and similar proteins; Region: beta-trefoil_FSCN2_rpt3; cd23353" /db_xref="CDD:467461" misc_feature order(1012..1014,1120..1134) /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="putative actin-binding site [polypeptide binding]; other site" /db_xref="CDD:467461" misc_feature 1135..1470 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="fourth fascin-like domain, beta-trefoil fold, found in fascin-2 and similar proteins; Region: beta-trefoil_FSCN2_rpt4; cd23357" /db_xref="CDD:467465" misc_feature order(1135..1140,1234..1236,1240..1242,1249..1251, 1255..1257,1342..1347) /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="putative actin-binding site 2 [polypeptide binding]; other site" /db_xref="CDD:467465" misc_feature 1153..1167 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /note="putative actin-binding site 1 [polypeptide binding]; other site" /db_xref="CDD:467465" exon 1..820 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /inference="alignment:Splign:2.1.0" exon 821..977 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /inference="alignment:Splign:2.1.0" exon 978..1099 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /inference="alignment:Splign:2.1.0" exon 1100..1267 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /inference="alignment:Splign:2.1.0" exon 1268..1473 /gene="fscn2b" /gene_synonym="fscn1l; fscn2; zgc:73272" /inference="alignment:Splign:2.1.0" ORIGIN
atgccctccaatggcaccaaagcccttaagcttcaattcgggcttattaatcatgagaatcgctacctaacggcggaggccttcggcttcaaggtgaacgcttcagctccaagcctcaagaagaagcagatctggactctagagcaagacgatcaggatggtcaggtggtttaccttcgtagtcacctagggcgctacctggcctctgacaaagatggcaaggtaagctgtgaggctgagactaaagagaatgactgtcgctttttgattgtggcacagtcagatggccgctgggccctgcagtctgagacatatttgcgctttttcggaggttcagaagactacttgtcgtgctttgctcagacaataggtgaggcagaactatgggccatgcatctagccctacacccacaagctaatctgcttagtgtggcccgcaaacgatatgcccacttggcatcgccagagggagagattgctgtagactgcaacatcccatggggtgttgatgcacttctaactcttgtgtacatggacggcaaatattgtcttaagaccagtgacagccgcttccttagcaatgatgggaaactgtcctctgaaaatggacgtggcacaggctacaccttggaactgaaatcaggcaaattggccttcaaggactgtgaggggaagtacttgacccccatggggcccactggaactctgcgctctggacgatgctccaaacctggcaaagatgagctgtttgatcttgaggaaagccatccgcaagtggtgtttcaggccgccaacaacagatttgtctccattcgacagggtgtgagcgtctcagccaatcaggacgatgagacagacatggagacgtttcaaatggaaattgataaagatacgagaaagtgcaaattcagaaccaatgaaggaaattattggacgctcgtcgctcatgggggcatccagtcaacagccacagaagccggtgccaacaccatgtttgacatcgtgtggctcggtcgacgggtggcactgcgggccagcaatggaaaatatgtatgtactaagaaaaacggccagctttctgcagtcagcgactctgtgggcgaggacgagcagctgattctgaagctgatcaacaggcccattctgatcctgaggggagaaaacggctatgtttgccaccacaaaaactcaaacacgctggacgccagtcgctcggtttatgacattttcacactgcagttcagtgatggtgcataccatattaaaggtgctggcgggaaattctggtatgtgtccagcagtggttwggtgtgttcagacggagacacgcctgaggatttcagctttgagttcttagagcacggacgaatagcgattagaggcaaaaacggcaaatacctgcggggagatcagggcgggaatctgaaaggagacggagagacggcggacagctcttccctctgggaatactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]