LOCUS       NM_199428               1601 bp    mRNA    linear   VRT 04-JAN-2026
DEFINITION  Danio rerio nucleophosmin 1a (npm1a), mRNA.
ACCESSION   NM_199428
VERSION     NM_199428.3
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1601)
  AUTHORS   Konar,G.J., Lingan,A.L., Vallone,K.T., Nguyen,T.D., Flickinger,Z.R.
            and Patton,J.G.
  TITLE     Depletion of Polypyrimidine tract binding protein 1 (ptbp1)
            activates Muller glia-derived proliferation during zebrafish retina
            regeneration via modulation of the senescence secretome
  JOURNAL   Exp Eye Res 257, 110420 (2025)
   PUBMED   40355064
REFERENCE   2  (bases 1 to 1601)
  AUTHORS   Konar,G.J., Vallone,K.T., Nguyen,T.D. and Patton,J.G.
  TITLE     Analysis of the senescence secretome during zebrafish retina
            regeneration
  JOURNAL   Front Aging 6, 1569422 (2025)
   PUBMED   40308558
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1601)
  AUTHORS   Xu,B., Tang,X., Jin,M., Zhang,H., Du,L., Yu,S. and He,J.
  TITLE     Unifying developmental programs for embryonic and postembryonic
            neurogenesis in the zebrafish retina
  JOURNAL   Development 147 (12) (2020)
   PUBMED   32467236
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1601)
  AUTHORS   Cheung,C.T., Pasquier,J., Bouleau,A., Nguyen,T., Chesnel,F.,
            Guiguen,Y. and Bobe,J.
  TITLE     Double maternal-effect: duplicated nucleoplasmin 2 genes, npm2a and
            npm2b, with essential but distinct functions are shared by fish and
            tetrapods
  JOURNAL   BMC Evol Biol 18 (1), 167 (2018)
   PUBMED   30419815
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1601)
  AUTHORS   Chakraborty,A., Uechi,T., Nakajima,Y., Gazda,H.T., O'Donohue,M.F.,
            Gleizes,P.E. and Kenmochi,N.
  TITLE     Cross talk between TP53 and c-Myc in the pathophysiology of
            Diamond-Blackfan anemia: Evidence from RPL11-deficient in vivo and
            in vitro models
  JOURNAL   Biochem Biophys Res Commun 495 (2), 1839-1845 (2018)
   PUBMED   29225165
REFERENCE   6  (bases 1 to 1601)
  AUTHORS   Bolli,N., Payne,E.M., Grabher,C., Lee,J.S., Johnston,A.B.,
            Falini,B., Kanki,J.P. and Look,A.T.
  TITLE     Expression of the cytoplasmic NPM1 mutant (NPMc+) causes the
            expansion of hematopoietic cells in zebrafish
  JOURNAL   Blood 115 (16), 3329-3340 (2010)
   PUBMED   20197555
REFERENCE   7  (bases 1 to 1601)
  AUTHORS   Jovelin,R., Yan,Y.L., He,X., Catchen,J., Amores,A., Canestro,C.,
            Yokoi,H. and Postlethwait,J.H.
  TITLE     Evolution of developmental regulation in the vertebrate FgfD
            subfamily
  JOURNAL   J Exp Zool B Mol Dev Evol 314 (1), 33-56 (2010)
   PUBMED   19562753
REFERENCE   8  (bases 1 to 1601)
  AUTHORS   Skarie,J.M. and Link,B.A.
  TITLE     The primary open-angle glaucoma gene WDR36 functions in ribosomal
            RNA processing and interacts with the p53 stress-response pathway
  JOURNAL   Hum Mol Genet 17 (16), 2474-2485 (2008)
   PUBMED   18469340
REFERENCE   9  (bases 1 to 1601)
  AUTHORS   Wotton,K.R., Weierud,F.K., Dietrich,S. and Lewis,K.E.
  TITLE     Comparative genomics of Lbx loci reveals conservation of identical
            Lbx ohnologs in bony vertebrates
  JOURNAL   BMC Evol Biol 8, 171 (2008)
   PUBMED   18541024
  REMARK    Publication Status: Online-Only
REFERENCE   10 (bases 1 to 1601)
  AUTHORS   Wang,D., Jao,L.E., Zheng,N., Dolan,K., Ivey,J., Zonies,S., Wu,X.,
            Wu,K., Yang,H., Meng,Q., Zhu,Z., Zhang,B., Lin,S. and Burgess,S.M.
  TITLE     Efficient genome-wide mutagenesis of zebrafish genes by retroviral
            insertions
  JOURNAL   Proc Natl Acad Sci U S A 104 (30), 12428-12433 (2007)
   PUBMED   17640903
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JBMGRA010000010.1.
            
            On Dec 9, 2025 this sequence version replaced NM_199428.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC053240.1, GDQH01002494.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-173               JBMGRA010000010.1  26911443-26911615
            174-253             JBMGRA010000010.1  26912504-26912583
            254-373             JBMGRA010000010.1  26912723-26912842
            374-467             JBMGRA010000010.1  26912932-26913025
            468-574             JBMGRA010000010.1  26913105-26913211
            575-612             JBMGRA010000010.1  26913293-26913330
            613-682             JBMGRA010000010.1  26920264-26920333
            683-760             JBMGRA010000010.1  26920423-26920500
            761-859             JBMGRA010000010.1  26920593-26920691
            860-934             JBMGRA010000010.1  26920780-26920854
            935-1601            JBMGRA010000010.1  26923570-26924236
FEATURES             Location/Qualifiers
     source          1..1601
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="10"
                     /map="10"
     gene            1..1601
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /note="nucleophosmin 1a"
                     /db_xref="GeneID:266985"
                     /db_xref="ZFIN:ZDB-GENE-021028-1"
     exon            1..173
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    2..4
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /note="upstream in-frame stop codon"
     CDS             134..976
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /note="nucleophosmin 1; nucleophosmin 1a (nucleolar
                     phosphoprotein B23, numatrin)"
                     /codon_start=1
                     /product="nucleophosmin 1a"
                     /protein_id="NP_955460.3"
                     /db_xref="GeneID:266985"
                     /db_xref="ZFIN:ZDB-GENE-021028-1"
                     /translation="

MDLEQMGPQTFLYGCELKAGKDITFNPEDDDYDHQLSVRMACVDPSTKDELNVVEIEGQDSEGQKVKAVLATLKPSTLPSVCLGGFEITPPVVFRLRTGSGPVHISGQHLVIMGGDQSFDEEEEEEEEEETVMTSKKRPALSTPKPSKKMKMDEEDDDDDDEDDDDDEDDDEEDESEEESPVKEKKAPAKPKTPTQNGKGPKPSTPAKQTPQKGKKEQTPKMPQTPRTLADIKSKMMESVAKGVSLPKVQLKFENYVNNCFKGTDPKVVEELWKWRQTVK"

     misc_feature    167..466
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /note="Nucleoplasmin/nucleophosmin domain; Region:
                     Nucleoplasmin; pfam03066"
                     /db_xref="CDD:460792"
     misc_feature    821..967
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /note="Nucleophosmin C-terminal domain; Region: NPM1-C;
                     pfam16276"
                     /db_xref="CDD:465081"
     exon            174..253
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            254..373
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            374..467
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            468..574
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            575..612
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            613..682
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            683..760
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            761..859
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            860..934
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
     exon            935..1601
                     /gene="npm1a"
                     /gene_synonym="npm1; sb:cb487"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gtgattggctggaccggaggaccgtcacagtagtgggcgtgatttactcgatgtgggtcagtgtgctcttcctgcactcgtgttcgctgactgcacatttcagccgacgtacagtcacacacagcctgcagacatggatctcgaacagatgggtccccaaaccttcctgtacggttgtgaactgaaagcaggcaaggatatcacgtttaatccagaggatgatgattatgatcatcaattatcggttagaatggcctgtgtggatccctcgacaaaagatgaattgaatgttgtggagattgaaggacaagattcagagggtcagaaggtcaaggcagttctagcaacactcaagccttcaactctcccaagtgtatgtttgggtgggtttgagatcacgccaccggttgttttccgtctgcgcactggttctggtccggttcacattagtggacagcatcttgttatcatgggaggagatcagtcttttgatgaggaggaggaggaggaggaagaagaggaaaccgtgatgacatccaagaagaggccagcgctgtcaactccaaagccttcaaaaaaaatgaagatggatgaggaagatgacgatgatgatgatgaggacgatgatgatgatgaagatgacgatgaggaagatgaaagtgaagaggagtcacctgtgaaagaaaagaaagcaccagcgaaaccaaagacccctacacagaatggaaaaggacccaaacccagtacacctgctaaacagactccacaaaagggcaagaaagaacagacacccaaaatgccacaaacaccacggactttagccgatatcaagtccaagatgatggagagtgtagcaaagggtgtgtcattaccaaaagtacagctgaagtttgagaactatgtgaataactgcttcaaaggcacagatccaaaggttgttgaggagctctggaagtggagacagactgtcaaataaatgaactaaaacgccttttattttgcttaaattaagcccctttcccacacgattttacttttgttacctgcaattttatgtttgtttgtccccatacctttcagtttttatgttaaatccgtgccattcctcgaaatgacttgaaacaacttgaccttgttcagtctgccttgtccttaccctcagtcatgtcatttgagtgtgaggttaacttggctgcagtattgctcaattatgaagctctgatttatataaagatatgttggtggtgcccgtccatgttttctttaaactgacatggaaatgtctgcatagctatctggttagatctgtgatgcgataatgcaatgtatgaatagtgggtttcagaatggcctcaatgtttaattctggtatttcagcagcagttgatattattttgtaattgtcattccctggaaagagttaaatgccattgtatgttcaggattgaatggtcttcagatgtcatcaatgtattgtaatgtcacagactttgcagccctgtctcaacagaatcaggactcaggacatttcagatgtggttctgttttttgactttctgaaatgtttaaatgcaaataaaggatatatttcacaactgaaa

//