GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-24 02:12:34, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       NM_152964               2113 bp    mRNA    linear   VRT 19-APR-2025
DEFINITION  Danio rerio gastrulation brain homeobox 2 (gbx2), mRNA.
ACCESSION   NM_152964
VERSION     NM_152964.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 2113)
  AUTHORS   Maekawa,M., Saito,S., Isobe,D., Takemoto,K., Miura,Y., Dobashi,Y.
            and Yamasu,K.
  TITLE     The Oct4-related PouV gene, pou5f3, mediates isthmus development in
            zebrafish by directly and dynamically regulating pax2a
  JOURNAL   Cells Dev 179, 203933 (2024)
   PUBMED   38908828
REFERENCE   2  (bases 1 to 2113)
  AUTHORS   Zhao,S., Wang,C., Luo,H., Li,F., Wang,Q., Xu,J., Huang,Z., Liu,W.
            and Zhang,W.
  TITLE     A role for Retinoblastoma 1 in hindbrain morphogenesis by
            regulating GBX family
  JOURNAL   J Genet Genomics 51 (9), 900-910 (2024)
   PUBMED   38570112
REFERENCE   3  (bases 1 to 2113)
  AUTHORS   Shainer,I., Kuehn,E., Laurell,E., Al Kassar,M., Mokayes,N.,
            Sherman,S., Larsch,J., Kunst,M. and Baier,H.
  TITLE     A single-cell resolution gene expression atlas of the larval
            zebrafish brain
  JOURNAL   Sci Adv 9 (8), eade9909 (2023)
   PUBMED   36812331
REFERENCE   4  (bases 1 to 2113)
  AUTHORS   Zhou,J., Yang,Y.J., Gan,R.H., Wang,Y., Li,Z., Zhang,X.J., Gui,J.F.
            and Zhou,L.
  TITLE     Foxl2a and Foxl2b are involved in midbrain-hindbrain boundary
            development in zebrafish
  JOURNAL   Gene Expr Patterns 46, 119286 (2022)
   PUBMED   36341978
REFERENCE   5  (bases 1 to 2113)
  AUTHORS   Brozko,N., Baggio,S., Lipiec,M.A., Jankowska,M., Szewczyk,L.M.,
            Gabriel,M.O., Chakraborty,C., Ferran,J.L. and Wisniewska,M.B.
  TITLE     Genoarchitecture of the Early Postmitotic Pretectum and the Role of
            Wnt Signaling in Shaping Pretectal Neurochemical Anatomy in
            Zebrafish
  JOURNAL   Front Neuroanat 16, 838567 (2022)
   PUBMED   35356436
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2113)
  AUTHORS   Emoto,Y., Wada,H., Okamoto,H., Kudo,A. and Imai,Y.
  TITLE     Retinoic acid-metabolizing enzyme Cyp26a1 is essential for
            determining territories of hindbrain and spinal cord in zebrafish
  JOURNAL   Dev Biol 278 (2), 415-427 (2005)
   PUBMED   15680360
REFERENCE   7  (bases 1 to 2113)
  AUTHORS   Rhinn,M., Lun,K., Werner,M., Simeone,A. and Brand,M.
  TITLE     Isolation and expression of the homeobox gene Gbx1 during mouse
            development
  JOURNAL   Dev Dyn 229 (2), 334-339 (2004)
   PUBMED   14745958
REFERENCE   8  (bases 1 to 2113)
  AUTHORS   Kikuta,H., Kanai,M., Ito,Y. and Yamasu,K.
  TITLE     gbx2 Homeobox gene is required for the maintenance of the isthmic
            region in the zebrafish embryonic brain
  JOURNAL   Dev Dyn 228 (3), 433-450 (2003)
   PUBMED   14579382
  REMARK    GeneRIF: Ectopic expression of gbx2 by mRNA injection caused
            cyclopia or truncation of the fore- and midbrain and severely
            affected isthmic and cerebellar structures.
REFERENCE   9  (bases 1 to 2113)
  AUTHORS   Rhinn,M., Lun,K., Amores,A., Yan,Y.L., Postlethwait,J.H. and
            Brand,M.
  TITLE     Cloning, expression and relationship of zebrafish gbx1 and gbx2
            genes to Fgf signaling
  JOURNAL   Mech Dev 120 (8), 919-936 (2003)
   PUBMED   12963112
  REMARK    GeneRIF: Here we report the isolation, mapping, chromosomal synteny
            and spatiotemporal expression of gbx1 and gbx2 in zebrafish. We
            focus in particular on the expression of these genes during
            development of the midbrain-hindbrain territory.
REFERENCE   10 (bases 1 to 2113)
  AUTHORS   Reim,G. and Brand,M.
  TITLE     Spiel-ohne-grenzen/pou2 mediates regional competence to respond to
            Fgf8 during zebrafish early neural development
  JOURNAL   Development 129 (4), 917-933 (2002)
   PUBMED   11861475
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB075028.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB075028.1, AF422807.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2113
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="6"
                     /map="6"
     gene            1..2113
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /note="gastrulation brain homeobox 2"
                     /db_xref="GeneID:245948"
                     /db_xref="ZFIN:ZDB-GENE-020509-2"
     exon            1..923
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    317..319
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /note="upstream in-frame stop codon"
     CDS             413..1441
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /function="transcription factor"
                     /note="gastrulation brain homeo box 2"
                     /codon_start=1
                     /product="homeobox protein GBX-2"
                     /protein_id="NP_694496.1"
                     /db_xref="GeneID:245948"
                     /db_xref="ZFIN:ZDB-GENE-020509-2"
                     /translation="
MSAAFSTPFMMMQRPVGSTTAFSIDSLIGGPPQPSPGHFVYTGYPMFMPYRSVVLPPPPPPPPPTLPQSALPTTHPHHPIPGLPSSFCSSLAQGMALTSTLMATLPGGFSSSPSQQHQDAARKLGSQSIHAMFDKSQDIRLDGEDGKTFATKDSTSIPSFHDSQSVHTSTVRGHSKDDSKEDDCHRKDESFSMDSDLDYSSDDNGPGNAMCQKEDGDGSGGLDDGVHGGNGAGNTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNVNSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP"
     misc_feature    1136..1306
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            924..2098
                     /gene="gbx2"
                     /gene_synonym="fd07f12; gbx-2; wu:fd07f12"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gatcacagctgatgctgcgaggagcaatttattgtgacttccatcaggtcgaaatgaaacgcggccaagcagaagggacaaggacgctgaaataactcaagggaggacgataaagctcatgtgagatgctcgacctttttctcgcccagacttttctcagccagggagttgtctgtgtttcaatgcacttgtctcgctctgttcttacggcgaactggctctgaatcgaggaagaagaaacagatgcaactgttttatgaaccgcacacacagaatcgttcagaggattaccaaaagctcagagagtgtcagtgtatgacgctgtccagcagtgagatcccaatctgagaagcgcagtggagaaagctgctcccagacttcaggacttcagaaactgtccacattagatcatatgagtgcagctttcagcacaccgttcatgatgatgcagcgtccggtgggaagcaccactgcattcagcattgactcgctcatcggcggtccgccgcagcccagtccgggacatttcgtgtacacaggttatcccatgttcatgccataccggtcagtggtgcttcctccgccgcctcctccaccccctccaacactcccccaaagcgctctccctacgacccatccgcaccacccgatcccgggcttacccagcagcttctgctccagcctggcgcagggcatggcactcacatccacgctaatggccacgttacccggcggcttctcctcctcgccgtcccaacagcaccaagacgcggcgaggaagctcggctctcagtctattcacgccatgttcgacaaatctcaggatattcgtttggatggagaggatgggaaaacgtttgcgacgaaagattcgacgagcattccgtccttccacgattcgcagtccgtacacacctctacagtgcgaggtcacagcaaagacgactcgaaggaggatgattgtcacaggaaagacgagagcttctccatggacagtgatttagattacagctccgatgataacgggcccgggaacgccatgtgtcagaaagaagacggagacggcagcggaggtctggacgacggcgttcacggtgggaatggggccgggaacaccacatccactgggaaaaatcggagaaggaggaccgcttttacgagcgagcaactgttggaactggagaaggagtttcactgtaagaaatatctgtccctcacagaacgctcgcaaatcgcgcacgccttaaagctcagcgaggtgcaggtcaagatctggtttcagaaccggagagccaagtggaaacgggtcaaagcgggcaacgtcaacagcaaaaccggagagccatccagaaaccccaaaattgtggtgcccattccggtgcatgttagtcggtttgcgatacgcagccaacaccaacagttagaacaggcccgaccttgatacacagggctttagtttccacaggacaaattggagacttaaatcggccaatacttaatatgaccaaccttttcttgagaggaaacaagtgacagtttggctgatagtttgtgccatatataaatatcatttccgtggaaaaagaagctcgaaagaaagcttcaaactaagacctcttactgggagaaaactgctgttttatttccgactttggaccaaatcacgaacacattttagttattgatattccactgtgtatttaaaagagataattggttttacgtttagctttgtgtgactgtctagttcgtgtgtttattggcagagatgaacattatcccaaaaggagcacttctggtctctgctgaagcacatgatataattcaattaatagtcaagttaacaccattccctcggatttaaaaaaacaacctgtttaaaaaaatgtgcttttctttttatggtcaaatctattattttaacgttttgctttgttttgttttcttgcattcgtttcccttttctgtaaccatttaagacatcacgggcacgctgctaatttatttaatattgtgagaagaaaacctgctaacgttttatcatgagtttacttcagaatattgtgtggattaaagctggaccataaacaattgtaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]