LOCUS       NM_131543               1175 bp    mRNA    linear   VRT 01-JUN-2024
DEFINITION  Danio rerio homeobox C13a (hoxc13a), mRNA.
ACCESSION   NM_131543
VERSION     NM_131543.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1175)
  AUTHORS   Cumplido,N., Arratia,G., Desvignes,T., Munoz-Sanchez,S.,
            Postlethwait,J.H. and Allende,M.L.
  TITLE     Hox genes control homocercal caudal fin development and evolution
  JOURNAL   Sci Adv 10 (3), eadj5991 (2024)
   PUBMED   38241378
REFERENCE   2  (bases 1 to 1175)
  AUTHORS   Zhang,J., Li,P., Sun,L., Jiang,N., Guo,W., Wang,J., Gao,F., Li,J.,
            Li,H., Zhang,J., Mu,H., Hu,Y. and Cui,X.
  TITLE     Knockout of miR-184 in zebrafish leads to ocular abnormalities by
            elevating p21 levels
  JOURNAL   FASEB J 37 (5), e22927 (2023)
   PUBMED   37086087
REFERENCE   3  (bases 1 to 1175)
  AUTHORS   Weiss,J.M., Hunter,M.V., Cruz,N.M., Baggiolini,A., Tagore,M.,
            Ma,Y., Misale,S., Marasco,M., Simon-Vermot,T., Campbell,N.R.,
            Newell,F., Wilmott,J.S., Johansson,P.A., Thompson,J.F., Long,G.V.,
            Pearson,J.V., Mann,G.J., Scolyer,R.A., Waddell,N., Montal,E.D.,
            Huang,T.H., Jonsson,P., Donoghue,M.T.A., Harris,C.C., Taylor,B.S.,
            Xu,T., Chaligne,R., Shliaha,P.V., Hendrickson,R., Jungbluth,A.A.,
            Lezcano,C., Koche,R., Studer,L., Ariyan,C.E., Solit,D.B.,
            Wolchok,J.D., Merghoub,T., Rosen,N., Hayward,N.K. and White,R.M.
  TITLE     Anatomic position determines oncogenic specificity in melanoma
  JOURNAL   Nature 604 (7905), 354-361 (2022)
   PUBMED   35355015
REFERENCE   4  (bases 1 to 1175)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   5  (bases 1 to 1175)
  AUTHORS   Ye,Z. and Kimelman,D.
  TITLE     Hox13 genes are required for mesoderm formation and axis elongation
            during early zebrafish development
  JOURNAL   Development 147 (22) (2020)
   PUBMED   33154036
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1175)
  AUTHORS   Kurosawa,G., Takamatsu,N., Takahashi,M., Sumitomo,M., Sanaka,E.,
            Yamada,K., Nishii,K., Matsuda,M., Asakawa,S., Ishiguro,H.,
            Miura,K., Kurosawa,Y., Shimizu,N., Kohara,Y. and Hori,H.
  TITLE     Organization and structure of hox gene loci in medaka genome and
            comparison with those of pufferfish and zebrafish genomes
  JOURNAL   Gene 370, 75-82 (2006)
   PUBMED   16472944
  REMARK    Erratum:[Gene. 2006 Jul;376(2):298-9]
REFERENCE   7  (bases 1 to 1175)
  AUTHORS   Corredor-Adamez,M., Welten,M.C., Spaink,H.P., Jeffery,J.E.,
            Schoon,R.T., de Bakker,M.A., Bagowski,C.P., Meijer,A.H.,
            Verbeek,F.J. and Richardson,M.K.
  TITLE     Genomic annotation and transcriptome analysis of the zebrafish
            (Danio rerio) hox complex with description of a novel member, hox b
            13a
  JOURNAL   Evol Dev 7 (5), 362-375 (2005)
   PUBMED   16174031
REFERENCE   8  (bases 1 to 1175)
  AUTHORS   Santini,S. and Bernardi,G.
  TITLE     Organization and base composition of tilapia Hox genes:
            implications for the evolution of Hox clusters in fish
  JOURNAL   Gene 346, 51-61 (2005)
   PUBMED   15716008
REFERENCE   9  (bases 1 to 1175)
  AUTHORS   Thummel,R., Li,L., Tanase,C., Sarras,M.P. Jr. and Godwin,A.R.
  TITLE     Differences in expression pattern and function between zebrafish
            hoxc13 orthologs: recruitment of Hoxc13b into an early embryonic
            role
  JOURNAL   Dev Biol 274 (2), 318-333 (2004)
   PUBMED   15385162
  REMARK    GeneRIF: has an expression pattern in the developing tail bud that
            is consistent with the gene playing a role in axial patterning
REFERENCE   10 (bases 1 to 1175)
  AUTHORS   Amores,A., Suzuki,T., Yan,Y.L., Pomeroy,J., Singer,A., Amemiya,C.
            and Postlethwait,J.H.
  TITLE     Developmental roles of pufferfish Hox clusters and genome evolution
            in ray-fin fish
  JOURNAL   Genome Res 14 (1), 1-10 (2004)
   PUBMED   14707165
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY452737.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY452737.1, BC134023.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1175
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="23"
                     /map="23"
     gene            1..1175
                     /gene="hoxc13a"
                     /note="homeobox C13a"
                     /db_xref="GeneID:58059"
                     /db_xref="ZFIN:ZDB-GENE-000822-4"
     exon            1..698
                     /gene="hoxc13a"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    11..13
                     /gene="hoxc13a"
                     /note="upstream in-frame stop codon"
     CDS             35..955
                     /gene="hoxc13a"
                     /note="homeo box C13a"
                     /codon_start=1
                     /product="homeobox protein Hox-C13a"
                     /protein_id="NP_571618.1"
                     /db_xref="GeneID:58059"
                     /db_xref="ZFIN:ZDB-GENE-000822-4"
                     /translation="

MTTSQVLHPRWADTLMYVYEKSPNENNQNKSQIMEGLSGNCPATHCRELISHPALGRHSGTIATHQGSVYSDISSPETGRQCPAPQTSSSASLSYGYPFGNPYYGCRLSHSHNVNLQQKPCSYHPAEKYAETSSALPTEELSSRAKEFAFYPSLASSYQAVPGYLDMSVVPSISVHPEPRHDALIPMEGYQHWALSNGWDGQVYCSKEQTQSSHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKIQLKELEKEYAASKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKFVSKSKTNNHMHT"

     misc_feature    134..466
                     /gene="hoxc13a"
                     /note="Hox protein A13 N terminal; Region: HoxA13_N;
                     pfam12284"
                     /db_xref="CDD:463521"
     misc_feature    743..913
                     /gene="hoxc13a"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            699..1162
                     /gene="hoxc13a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

aggcgacttttaaaaagcatcggcagcccgtgatatgacgacttcgcaggtcctgcatccacgctgggcggacaccttgatgtacgtgtatgaaaaaagtccgaatgaaaataatcaaaataaaagccaaattatggaaggattgagcgggaattgccctgcgactcattgcagggaactgatttcccaccccgcgctggggcgacactccggcaccatagcgactcaccagggatccgtgtactcggatatatcttcccctgaaactgggcgacagtgtcccgctcctcagacgtcatctagcgcttctctgagttacggctacccctttggaaacccttactatggttgcagattatctcactcgcacaatgtgaacttgcagcagaaaccatgttcataccatcccgcagaaaaatatgccgagacgagcagcgctttgcccacagaggagctctccagccgggcaaaagagtttgctttctatccgagtcttgccagctcttaccaggctgttccaggatatctagatatgtcggtggttccgagtattagcgttcatcccgagccacgtcacgatgcattgatccccatggagggctatcaacactgggctctctcgaatggctgggatgggcaggtgtactgttcaaaggagcaaacacagtcttctcatctttggaaatctccctttccagatgttgttccgttgcagccagaagtcagcagttatcgacgtgggcgcaaaaagcgtgttccctacaccaagatacaactgaaagaactagaaaaagagtatgcagcaagcaagtttatcaccaaagacaagagacgacgcatttctgcgacaaccaacctctcagaacgtcaagttactatttggttccagaaccgcagagtgaaggagaaaaagttcgtcagtaaatcaaagactaataatcacatgcatacttgatgtatgtatcgaacattttgttcgccagcttatatccttccgtccagaacgtctgatatttacttccgttcagcaatcatccgggcagtcccaagcctaacctgtcttctttcactttatttaatttaaaacgtacacacgattaccgcaatctctctggctttttgggcataagatacataactgtgaaaatacaaaaaaaaaaaaaaaaaaagggaaa

//