LOCUS       NM_131538                987 bp    mRNA    linear   VRT 03-APR-2024
DEFINITION  Danio rerio homeobox B6b (hoxb6b), mRNA.
ACCESSION   NM_131538 XM_001335154
VERSION     NM_131538.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 987)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   2  (bases 1 to 987)
  AUTHORS   Pak,B., Schmitt,C.E., Choi,W., Kim,J.D., Han,O., Alsio,J.,
            Jung,D.W., Williams,D.R., Coppieters,W., Stainier,D.Y.R. and
            Jin,S.W.
  TITLE     Analyses of Avascular Mutants Reveal Unique Transcriptomic
            Signature of Non-conventional Endothelial Cells
  JOURNAL   Front Cell Dev Biol 8, 589717 (2020)
   PUBMED   33330468
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 987)
  AUTHORS   Zhang,C. and Featherstone,M.
  TITLE     A zebrafish hox gene acts before gastrulation to specify the
            hemangioblast
  JOURNAL   Genesis 58 (6), e23363 (2020)
   PUBMED   32302038
REFERENCE   4  (bases 1 to 987)
  AUTHORS   Wang,J., Fei,F., Berberoglu,M.A., Sun,S., Wang,L., Dong,Z. and
            Wang,X.
  TITLE     Csy4-based vector system enables conditional chimeric gene editing
            in zebrafish without interrupting embryogenesis
  JOURNAL   J Mol Cell Biol 10 (6), 586-588 (2018)
   PUBMED   30063795
REFERENCE   5  (bases 1 to 987)
  AUTHORS   Malmstrom,M., Britz,R., Matschiner,M., Torresen,O.K., Hadiaty,R.K.,
            Yaakob,N., Tan,H.H., Jakobsen,K.S., Salzburger,W. and Ruber,L.
  TITLE     The Most Developmentally Truncated Fishes Show Extensive Hox Gene
            Loss and Miniaturized Genomes
  JOURNAL   Genome Biol Evol 10 (4), 1088-1103 (2018)
   PUBMED   29684203
REFERENCE   6  (bases 1 to 987)
  AUTHORS   Woods,I.G., Wilson,C., Friedlander,B., Chang,P., Reyes,D.K.,
            Nix,R., Kelly,P.D., Chu,F., Postlethwait,J.H. and Talbot,W.S.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   7  (bases 1 to 987)
  AUTHORS   Saito,R., Tabata,Y., Muto,A., Arai,K. and Watanabe,S.
  TITLE     Melk-like kinase plays a role in hematopoiesis in the zebra fish
  JOURNAL   Mol Cell Biol 25 (15), 6682-6693 (2005)
   PUBMED   16024803
REFERENCE   8  (bases 1 to 987)
  AUTHORS   Santini,S. and Bernardi,G.
  TITLE     Organization and base composition of tilapia Hox genes:
            implications for the evolution of Hox clusters in fish
  JOURNAL   Gene 346, 51-61 (2005)
   PUBMED   15716008
REFERENCE   9  (bases 1 to 987)
  AUTHORS   Amores,A., Suzuki,T., Yan,Y.L., Pomeroy,J., Singer,A., Amemiya,C.
            and Postlethwait,J.H.
  TITLE     Developmental roles of pufferfish Hox clusters and genome evolution
            in ray-fin fish
  JOURNAL   Genome Res 14 (1), 1-10 (2004)
   PUBMED   14707165
REFERENCE   10 (bases 1 to 987)
  AUTHORS   Davidson,A.J., Ernst,P., Wang,Y., Dekens,M.P., Kingsley,P.D.,
            Palis,J., Korsmeyer,S.J., Daley,G.Q. and Zon,L.I.
  TITLE     cdx4 mutants fail to specify blood progenitors and can be rescued
            by multiple hox genes
  JOURNAL   Nature 425 (6955), 300-306 (2003)
   PUBMED   13679919
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC162890.1.
            
            On May 8, 2009 this sequence version replaced XM_001335154.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC162868.1, CB354292.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..987
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="12"
                     /map="12"
     gene            1..987
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /note="homeobox B6b"
                     /db_xref="GeneID:58053"
                     /db_xref="ZFIN:ZDB-GENE-000823-7"
     exon            1..547
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    97..99
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /note="upstream in-frame stop codon"
     CDS             127..801
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /note="hox-A7; homeo box B6b; homeobox protein Hox-A7;
                     homeobox gene A-7"
                     /codon_start=1
                     /product="homeobox protein Hox-B6b"
                     /protein_id="NP_571613.1"
                     /db_xref="GeneID:58053"
                     /db_xref="ZFIN:ZDB-GENE-000823-7"
                     /translation="

MSSYFVNSTFPVSLPGGQESFLGQIPLYSSGYTDSLRHYPSATFGATNVQDKVYTSSYYQQAGGVFGRSGSTSACDYSTPNIYRSADRSCAIGSLEDSLVLTQDQCKTDCTEQGTERYFSTEDKPCTPVYPWMQRMNSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKAVNSAKVSDEEDGGKAG"

     misc_feature    511..528
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YGT4.2);
                     Region: Antp-type hexapeptide"
     misc_feature    568..738
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            548..987
                     /gene="hoxb6b"
                     /gene_synonym="hoxa7; z-5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctcagattggaacctcgccacccccccttcggctaaaaccaaatctcagataaagtaatggcaaataccacttggactataaaacacaacaaatcataacacacggacaataacactggccaccccatgagttcctatttcgtcaactcaacttttcccgtgtctctacccggaggacaggagtctttcttgggtcagataccgctatattcctctggatatacagattctttaagacattatccaagcgctacgttcggagctaccaatgtccaagacaaggtttacacctcctcgtattatcagcaagctgggggtgtttttgggagaagcggatccaccagtgcttgtgactactcaacacccaatatttaccgatccgctgaccgctcgtgcgctattggaagtctggaagactcgctggtcctaacccaggaccagtgcaagacggactgcacagaacagggcacagagagatattttagcactgaagataaaccatgtaccccggtttacccgtggatgcagaggatgaactcatgtaatggaatgcctggcagcactggccgcaggggtcgtcaaacctacactcggtttcagactcttgaactggaaaaggagttccactttaacagatatttgacaagaaggcgaagaattgaaatatcgcacgctctgtgtttgacggaacgacagatcaagatatggttccaaaaccgcagaatgaaatggaaaaaggagaataaagcagtgaactcggcaaaggtcagcgatgaggaagatggtggaaaggctggataaatgctaaaaaacagcttatgacgaagccctagaaacactgtacataacatgtagaatgtagttttaattaatacatacatgttctttccaacaagaaaaaaaactacctaataagtgttatgtcgactccaaaatgcttcaagagagatttctttcttataaaaacaggcatcgaactcacctctg

//