LOCUS       NM_131533                777 bp    mRNA    linear   VRT 17-MAR-2024
DEFINITION  Danio rerio homeobox A9b (hoxa9b), mRNA.
ACCESSION   NM_131533
VERSION     NM_131533.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 777)
  AUTHORS   Albert,L., Nagpal,J., Steinchen,W., Zhang,L., Werel,L.,
            Djokovic,N., Ruzic,D., Hoffarth,M., Xu,J., Kaspareit,J.,
            Abendroth,F., Royant,A., Bange,G., Nikolic,K., Ryu,S., Dou,Y.,
            Essen,L.O. and Vazquez,O.
  TITLE     Bistable Photoswitch Allows in Vivo Control of Hematopoiesis
  JOURNAL   ACS Cent Sci 8 (1), 57-66 (2022)
   PUBMED   35106373
REFERENCE   2  (bases 1 to 777)
  AUTHORS   Soto,R.A., Najia,M.A.T., Hachimi,M., Frame,J.M., Yette,G.A.,
            Lummertz da Rocha,E., Stankunas,K., Daley,G.Q. and North,T.E.
  TITLE     Sequential regulation of hemogenic fate and hematopoietic stem and
            progenitor cell formation from arterial endothelium by Ezh1/2
  JOURNAL   Stem Cell Reports 16 (7), 1718-1734 (2021)
   PUBMED   34143974
REFERENCE   3  (bases 1 to 777)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   4  (bases 1 to 777)
  AUTHORS   Smeeton,J., Natarajan,N., Naveen Kumar,A., Miyashita,T., Baddam,P.,
            Fabian,P., Graf,D. and Crump,J.G.
  TITLE     Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia
            reveals post-embryonic roles of Nkx3.2 in the skeleton
  JOURNAL   Development 148 (2) (2021)
   PUBMED   33462117
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 777)
  AUTHORS   Rougeot,J., Chrispijn,N.D., Aben,M., Elurbe,D.M., Andralojc,K.M.,
            Murphy,P.J., Jansen,P.W.T.C., Vermeulen,M., Cairns,B.R. and
            Kamminga,L.M.
  TITLE     Maintenance of spatial gene expression by Polycomb-mediated
            repression after formation of a vertebrate body plan
  JOURNAL   Development 146 (19) (2019)
   PUBMED   31488564
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 777)
  AUTHORS   Wagner,G.P., Takahashi,K., Lynch,V., Prohaska,S.J., Fried,C.,
            Stadler,P.F. and Amemiya,C.
  TITLE     Molecular evolution of duplicated ray finned fish HoxA clusters:
            increased synonymous substitution rate and asymmetrical
            co-divergence of coding and non-coding sequences
  JOURNAL   J Mol Evol 60 (5), 665-676 (2005)
   PUBMED   15983874
REFERENCE   7  (bases 1 to 777)
  AUTHORS   Santini,S. and Bernardi,G.
  TITLE     Organization and base composition of tilapia Hox genes:
            implications for the evolution of Hox clusters in fish
  JOURNAL   Gene 346, 51-61 (2005)
   PUBMED   15716008
REFERENCE   8  (bases 1 to 777)
  AUTHORS   Yekta,S., Shih,I.H. and Bartel,D.P.
  TITLE     MicroRNA-directed cleavage of HOXB8 mRNA
  JOURNAL   Science 304 (5670), 594-596 (2004)
   PUBMED   15105502
REFERENCE   9  (bases 1 to 777)
  AUTHORS   Chiu,C.H., Amemiya,C., Dewar,K., Kim,C.B., Ruddle,F.H. and
            Wagner,G.P.
  TITLE     Molecular evolution of the HoxA cluster in the three major
            gnathostome lineages
  JOURNAL   Proc Natl Acad Sci U S A 99 (8), 5492-5497 (2002)
   PUBMED   11943847
REFERENCE   10 (bases 1 to 777)
  AUTHORS   Snell,E.A., Scemama,J.L. and Stellwag,E.J.
  TITLE     Genomic organization of the Hoxa4-Hoxa10 region from Morone
            saxatilis: implications for Hox gene evolution among vertebrates
  JOURNAL   J Exp Zool 285 (1), 41-49 (1999)
   PUBMED   10327649
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF071249.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
FEATURES             Location/Qualifiers
     source          1..777
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="16"
                     /map="16"
     gene            1..777
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /note="homeobox A9b"
                     /db_xref="GeneID:58048"
                     /db_xref="ZFIN:ZDB-GENE-000823-2"
     CDS             1..777
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /note="homeo box A9b"
                     /codon_start=1
                     /product="homeobox protein Hox-A9b"
                     /protein_id="NP_571608.1"
                     /db_xref="GeneID:58048"
                     /db_xref="ZFIN:ZDB-GENE-000823-2"
                     /translation="

MSTLGTLSYYADSHLPHENDDHLAPRFSSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIFGASWSPVQPTGASIAYHPYIHHPCSTGDSDGASVRPWALEPLPALPFTGLSTDTHQDIKLEPLVGSGECTTHTLLVAETDNNTTQTERKVPDDAVSNGSHDEKIPAETKLDLDPSKCNQDNPLSNWLHAKSTRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQNRRMKMKKCNKDRPKDI"

     misc_feature    1..522
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /note="Hox9 activation region; Region: Hox9_act;
                     pfam04617"
                     /db_xref="CDD:461369"
     misc_feature    577..747
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..538
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /inference="alignment:Splign:2.1.0"
     exon            539..777
                     /gene="hoxa9b"
                     /gene_synonym="Hoxa-9; zgc:110504"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgtcgacattgggaacactaagttactacgctgactcacaccttccacacgagaatgacgatcatttggcaccgaggttctcatctggacccgtggtccagcagcagtctcgtgaactgacgctacttgaatatagcgaacaagagccctatactttccaggccaaatcatccatttttggtgcgtcgtggagtcccgtgcagcccacaggcgcatctatcgcctaccacccatacattcatcacccatgttcaacaggagacagcgatggagcatccgtgcgtccctgggcgttagaaccgctgcctgcactgccattcacgggattatccacagatacgcatcaagatataaaacttgaaccattggttgggagtggtgagtgcaccacgcatacacttcttgtggctgagacagacaacaatacgacgcaaacggagaggaaggtaccagacgatgctgtttccaacggatcacatgatgagaaaattcctgcggagacgaagctagatctagacccaagtaagtgcaaccaagataaccctttgtccaactggctgcatgcgaagtccactaggaaaaagcggtgtccgtacactaagcaccaaacactcgagctggaaaaagaatttctgtttaatatgtacctctctcgcgaccgtagatatgaagtggcaagactcctaaatctcaccgagagacaagtcaaaatttggttccaaaaccgtaggatgaagatgaagaaatgcaataaagatcgcccaaaagacatttaa

//