2025-07-02 10:49:07, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_131530 1335 bp mRNA linear VRT 25-FEB-2025 DEFINITION Danio rerio homeobox C6b (hoxc6b), transcript variant 1, mRNA. ACCESSION NM_131530 VERSION NM_131530.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1335) AUTHORS Maeno,A., Koita,R., Nakazawa,H., Fujii,R., Yamada,K., Oikawa,S., Tani,T., Ishizaka,M., Satoh,K., Ishizu,A., Sugawara,T., Adachi,U., Kikuchi,M., Iwanami,N., Matsuda,M. and Kawamura,A. TITLE The Hox code responsible for the patterning of the anterior vertebrae in zebrafish JOURNAL Development 151 (14) (2024) PUBMED 38940461 REFERENCE 2 (bases 1 to 1335) AUTHORS Adachi,U., Koita,R., Seto,A., Maeno,A., Ishizu,A., Oikawa,S., Tani,T., Ishizaka,M., Yamada,K., Satoh,K., Nakazawa,H., Furudate,H., Kawakami,K., Iwanami,N., Matsuda,M. and Kawamura,A. TITLE Teleost Hox code defines regional identities competent for the formation of dorsal and anal fins JOURNAL Proc Natl Acad Sci U S A 121 (25), e2403809121 (2024) PUBMED 38861596 REFERENCE 3 (bases 1 to 1335) AUTHORS Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P. TITLE Discovery of seven hox genes in zebrafish thrombopoiesis JOURNAL Blood Cells Mol Dis 104, 102796 (2024) PUBMED 37717409 REFERENCE 4 (bases 1 to 1335) AUTHORS Mukaigasa,K., Sakuma,C. and Yaginuma,H. TITLE The developmental hourglass model is applicable to the spinal cord based on single-cell transcriptomes and non-conserved cis-regulatory elements JOURNAL Dev Growth Differ 63 (7), 372-391 (2021) PUBMED 34473348 REFERENCE 5 (bases 1 to 1335) AUTHORS Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M., Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N. and Kawamura,A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 6 (bases 1 to 1335) AUTHORS Kurosawa,G., Takamatsu,N., Takahashi,M., Sumitomo,M., Sanaka,E., Yamada,K., Nishii,K., Matsuda,M., Asakawa,S., Ishiguro,H., Miura,K., Kurosawa,Y., Shimizu,N., Kohara,Y. and Hori,H. TITLE Organization and structure of hox gene loci in medaka genome and comparison with those of pufferfish and zebrafish genomes JOURNAL Gene 370, 75-82 (2006) PUBMED 16472944 REMARK Erratum:[Gene. 2006 Jul;376(2):298-9] REFERENCE 7 (bases 1 to 1335) AUTHORS Corredor-Adamez,M., Welten,M.C., Spaink,H.P., Jeffery,J.E., Schoon,R.T., de Bakker,M.A., Bagowski,C.P., Meijer,A.H., Verbeek,F.J. and Richardson,M.K. TITLE Genomic annotation and transcriptome analysis of the zebrafish (Danio rerio) hox complex with description of a novel member, hox b 13a JOURNAL Evol Dev 7 (5), 362-375 (2005) PUBMED 16174031 REFERENCE 8 (bases 1 to 1335) AUTHORS Santini,S. and Bernardi,G. TITLE Organization and base composition of tilapia Hox genes: implications for the evolution of Hox clusters in fish JOURNAL Gene 346, 51-61 (2005) PUBMED 15716008 REFERENCE 9 (bases 1 to 1335) AUTHORS Thummel,R., Li,L., Tanase,C., Sarras,M.P. Jr. and Godwin,A.R. TITLE Differences in expression pattern and function between zebrafish hoxc13 orthologs: recruitment of Hoxc13b into an early embryonic role JOURNAL Dev Biol 274 (2), 318-333 (2004) PUBMED 15385162 REFERENCE 10 (bases 1 to 1335) AUTHORS Yekta,S., Shih,I.H. and Bartel,D.P. TITLE MicroRNA-directed cleavage of HOXB8 mRNA JOURNAL Science 304 (5670), 594-596 (2004) PUBMED 15105502 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CABZ01085067.1. On Jun 8, 2016 this sequence version replaced NM_131530.1. Transcript Variant: This variant (1) encodes the longer isoform (1). Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-432 CABZ01085067.1 22503-22934 c 433-1335 CABZ01085067.1 21167-22069 c FEATURES Location/Qualifiers source 1..1335 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="11" /map="11" gene 1..1335 /gene="hoxc6b" /gene_synonym="hoxy6" /note="homeobox C6b" /db_xref="GeneID:58045" /db_xref="ZFIN:ZDB-GENE-000822-1" exon 1..432 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" CDS 51..734 /gene="hoxc6b" /gene_synonym="hoxy6" /note="isoform 1 is encoded by transcript variant 1; homeobox protein Hox-C6b; homeobox gene Y-6; homeo box C6b" /codon_start=1 /product="homeobox protein Hox-C6b isoform 1" /protein_id="NP_571605.2" /db_xref="GeneID:58045" /db_xref="ZFIN:ZDB-GENE-000822-1" /translation="
MNSYFTNPSLSCHLNSGQEVLPSVAISSTNYDPVRHFSPYGAAVAQNRIYSNPFYSHQENVMFGSSRPYDYGSNMFYQDKDVLPSCRQGFGQTQGSLTQDYASDQGKTMEPKGSVQIYPWMQRMNSHRVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDKEETGETAEKDEHD"
misc_feature 399..416 /gene="hoxc6b" /gene_synonym="hoxy6" /note="propagated from UniProtKB/Swiss-Prot (Q9PWM5.1); Region: Antp-type hexapeptide" misc_feature 456..626 /gene="hoxc6b" /gene_synonym="hoxy6" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 648..731 /gene="hoxc6b" /gene_synonym="hoxy6" /note="propagated from UniProtKB/Swiss-Prot (Q9PWM5.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 433..1335 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" ORIGIN
gggaagagaggcctaggaaaaaaaaagtgttgttttttaaagaagaagggatgaattcctattttacgaacccatcgctgtcgtgtcatttaaacagcggtcaagaagttctacccagcgttgccatcagctcgacaaactatgacccggtgcgacatttttcgccatatggcgccgccgttgcccaaaaccggatatactccaatccgttctattcacaccaagaaaacgttatgtttgggtcaagccgaccgtacgattacggatcaaatatgttctaccaggacaaagatgtgcttccaagttgcaggcaaggctttgggcaaacacagggttcattgacgcaggattacgcttcagaccaaggcaagactatggaaccgaaaggaagtgttcaaatatatccatggatgcagcggatgaactcgcatagagttggctatgggtctgacagacggcgaggtcgccaaatctattcgcgataccaaactttagaacttgagaaagaatttcattacaatcgctatttgacaagacgcagacgaattgagattgccaacacattgtgtctgtcggaacgccagattaaaatttggtttcagaaccgccggatgaaatggaagaaggagagcaatctcacgtccatcctcaatgacaatggctcggtaggagctggccaagacacggacaaagaagaaacaggggaaaccgccgaaaaagatgagcatgactgattgacttactaactaattaaaagacattccgtttgaaaacgttcttacataactaagctacctatggaatttacacaatttgcacaattaaaaccaaaaactgttacaattcctttagatgcaaagcgtgtgttgcttcgccacttatttcactatgattctgaaaagctgtttatccagagcaatttaattcataaatcagtgctctgactgaaaatgttttacctatcttgtgtgatttaatcttgtcattaaacatcttatttgttctgatgtactctgaagtgcaaataagggactgttgatgtagaccaaatatgaaaattccaaatattaaactacaatcatttcttctggtcctaggaagtgcattgtacatgtttgtaaatatgagattcaaatacttttgatgagcatttgtttagattgacgtactgttttgtgttttttctttactttgtgatgcgttctgggagaaccacatacgttgtaaaaagtatccttcattactctttttttccaaatgttgaattttagcaaaaaagcaagataataaaatgttcgaacatttacgcaataaagttgtaatcaatataacaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]