GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-14 01:58:20, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_131278                996 bp    mRNA    linear   VRT 20-JUL-2025
DEFINITION  Danio rerio POU class 4 homeobox 3 (pou4f3), mRNA.
ACCESSION   NM_131278
VERSION     NM_131278.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 996)
  AUTHORS   Lin,S.J., Huang,K., Petree,C., Qin,W., Varshney,P. and
            Varshney,G.K.
  TITLE     Optimizing gRNA selection for high-penetrance F0 CRISPR screening
            for interrogating disease gene function
  JOURNAL   Nucleic Acids Res 53 (5) (2025)
   PUBMED   40103232
REFERENCE   2  (bases 1 to 996)
  AUTHORS   Carpaneto Freixas,A.E., Moglie,M.J., Castagnola,T., Salatino,L.,
            Domene,S., Marcovich,I., Gallino,S., Wedemeyer,C., Goutman,J.D.,
            Plazas,P.V. and Elgoyhen,A.B.
  TITLE     Unraveling the Molecular Players at the Cholinergic Efferent
            Synapse of the Zebrafish Lateral Line
  JOURNAL   J Neurosci 41 (1), 47-60 (2021)
   PUBMED   33203744
REFERENCE   3  (bases 1 to 996)
  AUTHORS   Banerjee,B., Koner,D., Karasik,D. and Saha,N.
  TITLE     Genome-wide identification of novel long non-coding RNAs and their
            possible roles in hypoxic zebrafish brain
  JOURNAL   Genomics 113 (1 Pt 1), 29-43 (2021)
   PUBMED   33264657
REFERENCE   4  (bases 1 to 996)
  AUTHORS   Yu,R., Wang,P. and Chen,X.W.
  TITLE     The role of gfi1.2 in the development of zebrafish inner ear
  JOURNAL   Hear Res 396, 108055 (2020)
   PUBMED   32814237
REFERENCE   5  (bases 1 to 996)
  AUTHORS   Kozak,E.L., Palit,S., Miranda-Rodriguez,J.R., Janjic,A.,
            Bottcher,A., Lickert,H., Enard,W., Theis,F.J. and Lopez-Schier,H.
  TITLE     Epithelial Planar Bipolarity Emerges from Notch-Mediated Asymmetric
            Inhibition of Emx2
  JOURNAL   Curr Biol 30 (6), 1142-1151 (2020)
   PUBMED   32109392
REFERENCE   6  (bases 1 to 996)
  AUTHORS   Xiao,T., Roeser,T., Staub,W. and Baier,H.
  TITLE     A GFP-based genetic screen reveals mutations that disrupt the
            architecture of the zebrafish retinotectal projection
  JOURNAL   Development 132 (13), 2955-2967 (2005)
   PUBMED   15930106
REFERENCE   7  (bases 1 to 996)
  AUTHORS   Kay,J.N., Link,B.A. and Baier,H.
  TITLE     Staggered cell-intrinsic timing of ath5 expression underlies the
            wave of ganglion cell neurogenesis in the zebrafish retina
  JOURNAL   Development 132 (11), 2573-2585 (2005)
   PUBMED   15857917
REFERENCE   8  (bases 1 to 996)
  AUTHORS   Hua,J.Y., Smear,M.C., Baier,H. and Smith,S.J.
  TITLE     Regulation of axon growth in vivo by activity-based competition
  JOURNAL   Nature 434 (7036), 1022-1026 (2005)
   PUBMED   15846347
REFERENCE   9  (bases 1 to 996)
  AUTHORS   DeCarvalho,A.C., Cappendijk,S.L. and Fadool,J.M.
  TITLE     Developmental expression of the POU domain transcription factor
            Brn-3b (Pou4f2) in the lateral line and visual system of zebrafish
  JOURNAL   Dev Dyn 229 (4), 869-876 (2004)
   PUBMED   15042710
REFERENCE   10 (bases 1 to 996)
  AUTHORS   Spaniol,P., Bornmann,C., Hauptmann,G. and Gerster,T.
  TITLE     Class III POU genes of zebrafish are predominantly expressed in the
            central nervous system
  JOURNAL   Nucleic Acids Res 24 (24), 4874-4881 (1996)
   PUBMED   9016656
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY995217.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY995217.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505373, SAMEA3505374
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..996
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..996
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /note="POU class 4 homeobox 3"
                     /db_xref="GeneID:30534"
                     /db_xref="ZFIN:ZDB-GENE-990415-24"
     CDS             1..996
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /note="brain-3.1; zfbrn-3.1; brain-specific homeobox/POU
                     domain protein 3.1; brain POU domain gene 3.1"
                     /codon_start=1
                     /product="POU domain, class 4, transcription factor 3"
                     /protein_id="NP_571353.1"
                     /db_xref="GeneID:30534"
                     /db_xref="ZFIN:ZDB-GENE-990415-24"
                     /translation="
MMTMNGKQHFSMHPALHPSSEGMRRVCLPAPQLQGNIFSGFDESLLARAEALAAADIVSHGKSHPFKTDVTYHTMSSVPCTSSSSTVPISHPSSNLPSHHHHHLSHQTLEGDLLDHISSSLSVSGMGAPPDPSVMTTQAHQHHLQMGHLHQAMAMGHPHTLSVHNGMACVNDVESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNGKPDLFNGNERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH"
     misc_feature    241..324
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /note="propagated from UniProtKB/Swiss-Prot (Q90435.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    514..747
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    802..972
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..96
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /inference="alignment:Splign:2.1.0"
     exon            97..996
                     /gene="pou4f3"
                     /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgatgaccatgaacggcaagcagcacttctccatgcaccctgcgctgcacccgagctccgagggcatgcggcgggtgtgcctacctgccccgcagctccagggcaatatattcagcggctttgatgagagtctgctggcccgcgctgaagctctggcggcggctgacatcgtgtctcacggcaagagtcaccctttcaagacggacgtcacctaccataccatgagcagcgtgccctgcacctcctcttcgtccacagtgcccatatctcacccatcatccaacctcccgtcgcatcatcaccaccacctcagccaccagaccctggagggggacctactcgaccacatttcctcgagtttatcggtcagcggcatgggggcgccgccggatccatcggtgatgaccacacaagcccaccagcatcacctgcaaatgggtcacttacaccaagcaatggcgatgggccacccgcacaccctgtcggtccacaacggcatggcgtgcgtcaacgacgtcgagtccgatccaagagagctggaggcgttcgcggagaggttcaagcagcggaggataaagttaggagtgacccaggcggatgtgggctctgctctcgccaacctgaagataccgggggtcggctcgctgagccaaagcaccatctgcaggttcgagtccttaacactttcacacaacaacatgatcgccctcaaacccgtcctccaagcttggctggaggaagctgaagctgcttaccgggagaaaaacgggaaaccggaccttttcaatgggaacgagaggaaacgaaagcgtacgtccatcgcagctccggagaagcgatcgctcgaggcatattttgcaatccagccgcgaccgtcgtcggaaaaaatcgcggctatcgcggagaagttggatctaaagaagaacgtggttcgggtttggttctgtaatcaacggcaaaaacagaaaaggatgaagtattcagcagtgcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]