ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 17:24:56, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_131278 996 bp mRNA linear VRT 20-JUL-2025 DEFINITION Danio rerio POU class 4 homeobox 3 (pou4f3), mRNA. ACCESSION NM_131278 VERSION NM_131278.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 996) AUTHORS Lin,S.J., Huang,K., Petree,C., Qin,W., Varshney,P. and Varshney,G.K. TITLE Optimizing gRNA selection for high-penetrance F0 CRISPR screening for interrogating disease gene function JOURNAL Nucleic Acids Res 53 (5) (2025) PUBMED 40103232 REFERENCE 2 (bases 1 to 996) AUTHORS Carpaneto Freixas,A.E., Moglie,M.J., Castagnola,T., Salatino,L., Domene,S., Marcovich,I., Gallino,S., Wedemeyer,C., Goutman,J.D., Plazas,P.V. and Elgoyhen,A.B. TITLE Unraveling the Molecular Players at the Cholinergic Efferent Synapse of the Zebrafish Lateral Line JOURNAL J Neurosci 41 (1), 47-60 (2021) PUBMED 33203744 REFERENCE 3 (bases 1 to 996) AUTHORS Banerjee,B., Koner,D., Karasik,D. and Saha,N. TITLE Genome-wide identification of novel long non-coding RNAs and their possible roles in hypoxic zebrafish brain JOURNAL Genomics 113 (1 Pt 1), 29-43 (2021) PUBMED 33264657 REFERENCE 4 (bases 1 to 996) AUTHORS Yu,R., Wang,P. and Chen,X.W. TITLE The role of gfi1.2 in the development of zebrafish inner ear JOURNAL Hear Res 396, 108055 (2020) PUBMED 32814237 REFERENCE 5 (bases 1 to 996) AUTHORS Kozak,E.L., Palit,S., Miranda-Rodriguez,J.R., Janjic,A., Bottcher,A., Lickert,H., Enard,W., Theis,F.J. and Lopez-Schier,H. TITLE Epithelial Planar Bipolarity Emerges from Notch-Mediated Asymmetric Inhibition of Emx2 JOURNAL Curr Biol 30 (6), 1142-1151 (2020) PUBMED 32109392 REFERENCE 6 (bases 1 to 996) AUTHORS Xiao,T., Roeser,T., Staub,W. and Baier,H. TITLE A GFP-based genetic screen reveals mutations that disrupt the architecture of the zebrafish retinotectal projection JOURNAL Development 132 (13), 2955-2967 (2005) PUBMED 15930106 REFERENCE 7 (bases 1 to 996) AUTHORS Kay,J.N., Link,B.A. and Baier,H. TITLE Staggered cell-intrinsic timing of ath5 expression underlies the wave of ganglion cell neurogenesis in the zebrafish retina JOURNAL Development 132 (11), 2573-2585 (2005) PUBMED 15857917 REFERENCE 8 (bases 1 to 996) AUTHORS Hua,J.Y., Smear,M.C., Baier,H. and Smith,S.J. TITLE Regulation of axon growth in vivo by activity-based competition JOURNAL Nature 434 (7036), 1022-1026 (2005) PUBMED 15846347 REFERENCE 9 (bases 1 to 996) AUTHORS DeCarvalho,A.C., Cappendijk,S.L. and Fadool,J.M. TITLE Developmental expression of the POU domain transcription factor Brn-3b (Pou4f2) in the lateral line and visual system of zebrafish JOURNAL Dev Dyn 229 (4), 869-876 (2004) PUBMED 15042710 REFERENCE 10 (bases 1 to 996) AUTHORS Spaniol,P., Bornmann,C., Hauptmann,G. and Gerster,T. TITLE Class III POU genes of zebrafish are predominantly expressed in the central nervous system JOURNAL Nucleic Acids Res 24 (24), 4874-4881 (1996) PUBMED 9016656 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY995217.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY995217.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505373, SAMEA3505374 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..996 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..996 /gene="pou4f3" /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c" /note="POU class 4 homeobox 3" /db_xref="GeneID:30534" /db_xref="ZFIN:ZDB-GENE-990415-24" CDS 1..996 /gene="pou4f3" /gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c" /note="brain-3.1; zfbrn-3.1; brain-specific homeobox/POU domain protein 3.1; brain POU domain gene 3.1" /codon_start=1 /product="POU domain, class 4, transcription factor 3" /protein_id="NP_571353.1" /db_xref="GeneID:30534" /db_xref="ZFIN:ZDB-GENE-990415-24" /translation="
MMTMNGKQHFSMHPALHPSSEGMRRVCLPAPQLQGNIFSGFDESLLARAEALAAADIVSHGKSHPFKTDVTYHTMSSVPCTSSSSTVPISHPSSNLPSHHHHHLSHQTLEGDLLDHISSSLSVSGMGAPPDPSVMTTQAHQHHLQMGHLHQAMAMGHPHTLSVHNGMACVNDVESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNGKPDLFNGNERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH"
misc_feature 241..324
/gene="pou4f3"
/gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
/note="propagated from UniProtKB/Swiss-Prot (Q90435.2);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 514..747
/gene="pou4f3"
/gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
/note="Found in Pit-Oct-Unc transcription factors; Region:
POU; smart00352"
/db_xref="CDD:197673"
misc_feature 802..972
/gene="pou4f3"
/gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 1..96
/gene="pou4f3"
/gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
/inference="alignment:Splign:2.1.0"
exon 97..996
/gene="pou4f3"
/gene_synonym="BRN-3.1; brn-3c; brn3.1; brn3c"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgatgaccatgaacggcaagcagcacttctccatgcaccctgcgctgcacccgagctccgagggcatgcggcgggtgtgcctacctgccccgcagctccagggcaatatattcagcggctttgatgagagtctgctggcccgcgctgaagctctggcggcggctgacatcgtgtctcacggcaagagtcaccctttcaagacggacgtcacctaccataccatgagcagcgtgccctgcacctcctcttcgtccacagtgcccatatctcacccatcatccaacctcccgtcgcatcatcaccaccacctcagccaccagaccctggagggggacctactcgaccacatttcctcgagtttatcggtcagcggcatgggggcgccgccggatccatcggtgatgaccacacaagcccaccagcatcacctgcaaatgggtcacttacaccaagcaatggcgatgggccacccgcacaccctgtcggtccacaacggcatggcgtgcgtcaacgacgtcgagtccgatccaagagagctggaggcgttcgcggagaggttcaagcagcggaggataaagttaggagtgacccaggcggatgtgggctctgctctcgccaacctgaagataccgggggtcggctcgctgagccaaagcaccatctgcaggttcgagtccttaacactttcacacaacaacatgatcgccctcaaacccgtcctccaagcttggctggaggaagctgaagctgcttaccgggagaaaaacgggaaaccggaccttttcaatgggaacgagaggaaacgaaagcgtacgtccatcgcagctccggagaagcgatcgctcgaggcatattttgcaatccagccgcgaccgtcgtcggaaaaaatcgcggctatcgcggagaagttggatctaaagaagaacgtggttcgggtttggttctgtaatcaacggcaaaaacagaaaaggatgaagtattcagcagtgcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]