GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-18 01:49:44, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_131227               1322 bp    mRNA    linear   VRT 13-JUL-2025
DEFINITION  Danio rerio retinal homeobox gene 3 (rx3), mRNA.
ACCESSION   NM_131227
VERSION     NM_131227.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1322)
  AUTHORS   Moreno-Sanchez,I., Hernandez-Huertas,L., Nahon-Cano,D.,
            Martinez-Garcia,P.M., Treichel,A.J., Gomez-Marin,C.,
            Tomas-Gallardo,L., da Silva Pescador,G., Kushawah,G., Egidy,R.,
            Perera,A., Diaz-Moscoso,A., Cano-Ruiz,A., Walker,J.A. 2nd,
            Munoz,M.J., Holden,K., Galceran,J., Nieto,M.A., Bazzini,A.A. and
            Moreno-Mateos,M.A.
  TITLE     Enhanced RNA-targeting CRISPR-Cas technology in zebrafish
  JOURNAL   Nat Commun 16 (1), 2591 (2025)
   PUBMED   40091120
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1322)
  AUTHORS   Lin,S.J., Huang,K., Petree,C., Qin,W., Varshney,P. and
            Varshney,G.K.
  TITLE     Optimizing gRNA selection for high-penetrance F0 CRISPR screening
            for interrogating disease gene function
  JOURNAL   Nucleic Acids Res 53 (5) (2025)
   PUBMED   40103232
REFERENCE   3  (bases 1 to 1322)
  AUTHORS   Cortes-Gonzalez,V., Rodriguez-Morales,M., Ataliotis,P., Mayer,C.,
            Plaisancie,J., Chassaing,N., Lee,H., Rozet,J.M., Cavodeassi,F. and
            Fares Taie,L.
  TITLE     Homozygosity for a hypomorphic mutation in frizzled class receptor
            5 causes syndromic ocular coloboma with microcornea in humans
  JOURNAL   Hum Genet 143 (12), 1509-1521 (2024)
   PUBMED   39503780
REFERENCE   4  (bases 1 to 1322)
  AUTHORS   Herget,U., Ryu,S. and De Marco,R.J.
  TITLE     Altered glucocorticoid reactivity and behavioral phenotype in
            rx3-/- larval zebrafish
  JOURNAL   Front Endocrinol (Lausanne) 14, 1187327 (2023)
   PUBMED   37484970
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1322)
  AUTHORS   Letelier,J., Buono,L., Almuedo-Castillo,M., Zang,J., Mounieres,C.,
            Gonzalez-Diaz,S., Polvillo,R., Sanabria-Reinoso,E., Corbacho,J.,
            Sousa-Ortega,A., Diez Del Corral,R., Neuhauss,S.C.F. and
            Martinez-Morales,J.R.
  TITLE     Mutation of vsx genes in zebrafish highlights the robustness of the
            retinal specification network
  JOURNAL   Elife 12, e85594 (2023)
   PUBMED   37227126
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1322)
  AUTHORS   Loosli,F., Staub,W., Finger-Baier,K.C., Ober,E.A., Verkade,H.,
            Wittbrodt,J. and Baier,H.
  TITLE     Loss of eyes in zebrafish caused by mutation of chokh/rx3
  JOURNAL   EMBO Rep 4 (9), 894-899 (2003)
   PUBMED   12947416
REFERENCE   7  (bases 1 to 1322)
  AUTHORS   Carreira-Barbosa,F., Concha,M.L., Takeuchi,M., Ueno,N., Wilson,S.W.
            and Tada,M.
  TITLE     Prickle 1 regulates cell movements during gastrulation and neuronal
            migration in zebrafish
  JOURNAL   Development 130 (17), 4037-4046 (2003)
   PUBMED   12874125
REFERENCE   8  (bases 1 to 1322)
  AUTHORS   Levkowitz,G., Zeller,J., Sirotkin,H.I., French,D., Schilbach,S.,
            Hashimoto,H., Hibi,M., Talbot,W.S. and Rosenthal,A.
  TITLE     Zinc finger protein too few controls the development of
            monoaminergic neurons
  JOURNAL   Nat Neurosci 6 (1), 28-33 (2003)
   PUBMED   12469125
REFERENCE   9  (bases 1 to 1322)
  AUTHORS   Kim,S.H., Shin,J., Park,H.C., Yeo,S.Y., Hong,S.K., Han,S., Rhee,M.,
            Kim,C.H., Chitnis,A.B. and Huh,T.L.
  TITLE     Specification of an anterior neuroectoderm patterning by
            Frizzled8a-mediated Wnt8b signalling during late gastrulation in
            zebrafish
  JOURNAL   Development 129 (19), 4443-4455 (2002)
   PUBMED   12223403
REFERENCE   10 (bases 1 to 1322)
  AUTHORS   Chuang,J.C., Mathers,P.H. and Raymond,P.A.
  TITLE     Expression of three Rx homeobox genes in embryonic and adult
            zebrafish
  JOURNAL   Mech Dev 84 (1-2), 195-198 (1999)
   PUBMED   10473141
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF001909.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF001909.1, BC163788.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505371, SAMEA3505372
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1322
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..1322
                     /gene="rx3"
                     /note="retinal homeobox gene 3"
                     /db_xref="GeneID:30474"
                     /db_xref="ZFIN:ZDB-GENE-990415-238"
     CDS             14..892
                     /gene="rx3"
                     /note="eyes missing; chk; eym; chokh"
                     /codon_start=1
                     /product="retinal homeobox protein Rx3"
                     /protein_id="NP_571302.1"
                     /db_xref="GeneID:30474"
                     /db_xref="ZFIN:ZDB-GENE-990415-238"
                     /translation="
MRLVGSQYKDMEDRLSPSARLVRSPGSQTRIHSIESILGFKGETLFHPAFPYGSGKTGKDTEHLSPKKDSNKHFDGVCRSTVMVSPDLPDADGGKLSDDENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSIKLQESSMLSIPRSGPLSLGSGLPLEPWLTGPISTSSSPLQSLPSFITPQQAVPASYTPPQFLSSSTLNHSLPHIGAVCPPYQCSGFMDKFSLQEADPRNTSIASLRMKAKEHIQSIGKTW"
     misc_feature    14..94
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    107..130
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Octapeptide motif"
     misc_feature    170..229
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    266..334
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    332..502
                     /gene="rx3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    815..865
                     /gene="rx3"
                     /note="OAR motif; Region: OAR; pfam03826"
                     /db_xref="CDD:461067"
     misc_feature    827..868
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: OAR.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU00138"
     misc_feature    845..859
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000255"
ORIGIN      
ggcacgaggttcaatgaggcttgttggatctcagtataaagacatggaagatcgtctctctccatccgcgcgcttggtccgcagtcccgggtcccaaacgaggatccacagcattgagtcaattctgggatttaagggagagactctgtttcacccggcgtttccatatggatcgggaaagacaggcaaagacaccgagcacttgtccccgaaaaaggactcgaataaacactttgatggagtttgtaggtctactgtaatggtcagcccggatctgccagacgcggatggtggtaaattgtcggatgatgaaaacccaaagaaaaagcacaggcggaaccgaaccacgttcaccaccttccagctccacgagctcgagcgcgccttcgagaagtcgcactatccggatgtctacagcagagaggagctcgcgctgaaggtcaacctgcccgaagtccgagtacaggtgtggttccaaaaccgtcgagctaaatggcggcgacaggagaagctggaggtgagctccatcaagctgcaggagtcctccatgctctccatccccagatcggggccactgtccctgggcagtggcctgccgttagagccctggttgaccggccccatctccacctccagctctcctctgcaatctctgcccagcttcatcacccctcagcaggccgtcccagccagctacacccctccacagttcctcagctcctccaccctcaaccacagtctgcctcatataggggctgtgtgtcccccgtatcagtgctccggctttatggataaattttcacttcaagaagcagatccacgaaacacaagcatcgcctcgctgaggatgaaagccaaggaacacattcagtctatagggaagacgtggtagatgagagacattagagacttattttagtttgtatcttcaaaatcagtggtctggatccgtttttcttttctaaacttcagttgtggacgacaatctttgtaaaaacagataaacattgtacatgactttgatttttgggtcattgtagggcaggtggatctctttcagccctctttttaacctttaaagcagttgaagagggagttaggaatggaaatgcattataaatgcaggcttttagtttcattgaatcgcatttggcattcaaaaggcccgttctgtgctaggatttattctctgttgagtactgtacaatgcagctggccactttccatgatgttttgttgtatgttttcacacttgtacagatgaattttgtattttataataaaaacaaagtcataaaaataacaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]