GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-02 10:46:45, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_131227               1322 bp    mRNA    linear   VRT 03-AUG-2024
DEFINITION  Danio rerio retinal homeobox gene 3 (rx3), mRNA.
ACCESSION   NM_131227
VERSION     NM_131227.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1322)
  AUTHORS   Herget,U., Ryu,S. and De Marco,R.J.
  TITLE     Altered glucocorticoid reactivity and behavioral phenotype in
            rx3-/- larval zebrafish
  JOURNAL   Front Endocrinol (Lausanne) 14, 1187327 (2023)
   PUBMED   37484970
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1322)
  AUTHORS   Letelier,J., Buono,L., Almuedo-Castillo,M., Zang,J., Mounieres,C.,
            Gonzalez-Diaz,S., Polvillo,R., Sanabria-Reinoso,E., Corbacho,J.,
            Sousa-Ortega,A., Diez Del Corral,R., Neuhauss,S.C.F. and
            Martinez-Morales,J.R.
  TITLE     Mutation of vsx genes in zebrafish highlights the robustness of the
            retinal specification network
  JOURNAL   Elife 12, e85594 (2023)
   PUBMED   37227126
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1322)
  AUTHORS   Bulk,J., Kyrychenko,V., Rensinghoff,P.M., Ghaderi Ardekani,Z. and
            Heermann,S.
  TITLE     Holoprosencephaly with a Special Form of Anophthalmia Result from
            Experimental Induction of bmp4, Oversaturating BMP Antagonists in
            Zebrafish
  JOURNAL   Int J Mol Sci 24 (9), 8052 (2023)
   PUBMED   37175759
  REMARK    GeneRIF: Holoprosencephaly with a Special Form of Anophthalmia
            Result from Experimental Induction of bmp4, Oversaturating BMP
            Antagonists in Zebrafish.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1322)
  AUTHORS   Wysocka,E., Gonicka,A. and Anbalagan,S.
  TITLE     CRISPR-Cas9 F0 knockout approach using predesigned in vitro
            transcribed guide RNAs partially recapitulates Rx3 function in eye
            morphogenesis
  JOURNAL   J Genet 102 (2023)
   PUBMED   36722224
REFERENCE   5  (bases 1 to 1322)
  AUTHORS   Hernandez-Bejarano,M., Gestri,G., Monfries,C., Tucker,L.,
            Dragomir,E.I., Bianco,I.H., Bovolenta,P., Wilson,S.W. and
            Cavodeassi,F.
  TITLE     Foxd1-dependent induction of a temporal retinal character is
            required for visual function
  JOURNAL   Development 149 (24) (2022)
   PUBMED   36520654
REFERENCE   6  (bases 1 to 1322)
  AUTHORS   Loosli,F., Staub,W., Finger-Baier,K.C., Ober,E.A., Verkade,H.,
            Wittbrodt,J. and Baier,H.
  TITLE     Loss of eyes in zebrafish caused by mutation of chokh/rx3
  JOURNAL   EMBO Rep 4 (9), 894-899 (2003)
   PUBMED   12947416
REFERENCE   7  (bases 1 to 1322)
  AUTHORS   Carreira-Barbosa,F., Concha,M.L., Takeuchi,M., Ueno,N., Wilson,S.W.
            and Tada,M.
  TITLE     Prickle 1 regulates cell movements during gastrulation and neuronal
            migration in zebrafish
  JOURNAL   Development 130 (17), 4037-4046 (2003)
   PUBMED   12874125
REFERENCE   8  (bases 1 to 1322)
  AUTHORS   Levkowitz,G., Zeller,J., Sirotkin,H.I., French,D., Schilbach,S.,
            Hashimoto,H., Hibi,M., Talbot,W.S. and Rosenthal,A.
  TITLE     Zinc finger protein too few controls the development of
            monoaminergic neurons
  JOURNAL   Nat Neurosci 6 (1), 28-33 (2003)
   PUBMED   12469125
REFERENCE   9  (bases 1 to 1322)
  AUTHORS   Kim,S.H., Shin,J., Park,H.C., Yeo,S.Y., Hong,S.K., Han,S., Rhee,M.,
            Kim,C.H., Chitnis,A.B. and Huh,T.L.
  TITLE     Specification of an anterior neuroectoderm patterning by
            Frizzled8a-mediated Wnt8b signalling during late gastrulation in
            zebrafish
  JOURNAL   Development 129 (19), 4443-4455 (2002)
   PUBMED   12223403
REFERENCE   10 (bases 1 to 1322)
  AUTHORS   Chuang,J.C., Mathers,P.H. and Raymond,P.A.
  TITLE     Expression of three Rx homeobox genes in embryonic and adult
            zebrafish
  JOURNAL   Mech Dev 84 (1-2), 195-198 (1999)
   PUBMED   10473141
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF001909.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF001909.1, BC163788.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505371, SAMEA3505372
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1322
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..1322
                     /gene="rx3"
                     /note="retinal homeobox gene 3"
                     /db_xref="GeneID:30474"
                     /db_xref="ZFIN:ZDB-GENE-990415-238"
     CDS             14..892
                     /gene="rx3"
                     /note="eyes missing; chk; eym; chokh"
                     /codon_start=1
                     /product="retinal homeobox protein Rx3"
                     /protein_id="NP_571302.1"
                     /db_xref="GeneID:30474"
                     /db_xref="ZFIN:ZDB-GENE-990415-238"
                     /translation="
MRLVGSQYKDMEDRLSPSARLVRSPGSQTRIHSIESILGFKGETLFHPAFPYGSGKTGKDTEHLSPKKDSNKHFDGVCRSTVMVSPDLPDADGGKLSDDENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSIKLQESSMLSIPRSGPLSLGSGLPLEPWLTGPISTSSSPLQSLPSFITPQQAVPASYTPPQFLSSSTLNHSLPHIGAVCPPYQCSGFMDKFSLQEADPRNTSIASLRMKAKEHIQSIGKTW"
     misc_feature    14..94
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    107..130
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Octapeptide motif"
     misc_feature    170..229
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    266..334
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    332..502
                     /gene="rx3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    815..865
                     /gene="rx3"
                     /note="OAR motif; Region: OAR; pfam03826"
                     /db_xref="CDD:461067"
     misc_feature    827..868
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: OAR.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU00138"
     misc_feature    845..859
                     /gene="rx3"
                     /note="propagated from UniProtKB/Swiss-Prot (O42358.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000255"
ORIGIN      
ggcacgaggttcaatgaggcttgttggatctcagtataaagacatggaagatcgtctctctccatccgcgcgcttggtccgcagtcccgggtcccaaacgaggatccacagcattgagtcaattctgggatttaagggagagactctgtttcacccggcgtttccatatggatcgggaaagacaggcaaagacaccgagcacttgtccccgaaaaaggactcgaataaacactttgatggagtttgtaggtctactgtaatggtcagcccggatctgccagacgcggatggtggtaaattgtcggatgatgaaaacccaaagaaaaagcacaggcggaaccgaaccacgttcaccaccttccagctccacgagctcgagcgcgccttcgagaagtcgcactatccggatgtctacagcagagaggagctcgcgctgaaggtcaacctgcccgaagtccgagtacaggtgtggttccaaaaccgtcgagctaaatggcggcgacaggagaagctggaggtgagctccatcaagctgcaggagtcctccatgctctccatccccagatcggggccactgtccctgggcagtggcctgccgttagagccctggttgaccggccccatctccacctccagctctcctctgcaatctctgcccagcttcatcacccctcagcaggccgtcccagccagctacacccctccacagttcctcagctcctccaccctcaaccacagtctgcctcatataggggctgtgtgtcccccgtatcagtgctccggctttatggataaattttcacttcaagaagcagatccacgaaacacaagcatcgcctcgctgaggatgaaagccaaggaacacattcagtctatagggaagacgtggtagatgagagacattagagacttattttagtttgtatcttcaaaatcagtggtctggatccgtttttcttttctaaacttcagttgtggacgacaatctttgtaaaaacagataaacattgtacatgactttgatttttgggtcattgtagggcaggtggatctctttcagccctctttttaacctttaaagcagttgaagagggagttaggaatggaaatgcattataaatgcaggcttttagtttcattgaatcgcatttggcattcaaaaggcccgttctgtgctaggatttattctctgttgagtactgtacaatgcagctggccactttccatgatgttttgttgtatgttttcacacttgtacagatgaattttgtattttataataaaaacaaagtcataaaaataacaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]