2025-09-16 12:39:40, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_131227 1322 bp mRNA linear VRT 06-APR-2025 DEFINITION Danio rerio retinal homeobox gene 3 (rx3), mRNA. ACCESSION NM_131227 VERSION NM_131227.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1322) AUTHORS Cortes-Gonzalez,V., Rodriguez-Morales,M., Ataliotis,P., Mayer,C., Plaisancie,J., Chassaing,N., Lee,H., Rozet,J.M., Cavodeassi,F. and Fares Taie,L. TITLE Homozygosity for a hypomorphic mutation in frizzled class receptor 5 causes syndromic ocular coloboma with microcornea in humans JOURNAL Hum Genet 143 (12), 1509-1521 (2024) PUBMED 39503780 REFERENCE 2 (bases 1 to 1322) AUTHORS Herget,U., Ryu,S. and De Marco,R.J. TITLE Altered glucocorticoid reactivity and behavioral phenotype in rx3-/- larval zebrafish JOURNAL Front Endocrinol (Lausanne) 14, 1187327 (2023) PUBMED 37484970 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1322) AUTHORS Letelier,J., Buono,L., Almuedo-Castillo,M., Zang,J., Mounieres,C., Gonzalez-Diaz,S., Polvillo,R., Sanabria-Reinoso,E., Corbacho,J., Sousa-Ortega,A., Diez Del Corral,R., Neuhauss,S.C.F. and Martinez-Morales,J.R. TITLE Mutation of vsx genes in zebrafish highlights the robustness of the retinal specification network JOURNAL Elife 12, e85594 (2023) PUBMED 37227126 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1322) AUTHORS Bulk,J., Kyrychenko,V., Rensinghoff,P.M., Ghaderi Ardekani,Z. and Heermann,S. TITLE Holoprosencephaly with a Special Form of Anophthalmia Result from Experimental Induction of bmp4, Oversaturating BMP Antagonists in Zebrafish JOURNAL Int J Mol Sci 24 (9), 8052 (2023) PUBMED 37175759 REMARK GeneRIF: Holoprosencephaly with a Special Form of Anophthalmia Result from Experimental Induction of bmp4, Oversaturating BMP Antagonists in Zebrafish. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1322) AUTHORS Wysocka,E., Gonicka,A. and Anbalagan,S. TITLE CRISPR-Cas9 F0 knockout approach using predesigned in vitro transcribed guide RNAs partially recapitulates Rx3 function in eye morphogenesis JOURNAL J Genet 102 (2023) PUBMED 36722224 REFERENCE 6 (bases 1 to 1322) AUTHORS Loosli,F., Staub,W., Finger-Baier,K.C., Ober,E.A., Verkade,H., Wittbrodt,J. and Baier,H. TITLE Loss of eyes in zebrafish caused by mutation of chokh/rx3 JOURNAL EMBO Rep 4 (9), 894-899 (2003) PUBMED 12947416 REFERENCE 7 (bases 1 to 1322) AUTHORS Carreira-Barbosa,F., Concha,M.L., Takeuchi,M., Ueno,N., Wilson,S.W. and Tada,M. TITLE Prickle 1 regulates cell movements during gastrulation and neuronal migration in zebrafish JOURNAL Development 130 (17), 4037-4046 (2003) PUBMED 12874125 REFERENCE 8 (bases 1 to 1322) AUTHORS Levkowitz,G., Zeller,J., Sirotkin,H.I., French,D., Schilbach,S., Hashimoto,H., Hibi,M., Talbot,W.S. and Rosenthal,A. TITLE Zinc finger protein too few controls the development of monoaminergic neurons JOURNAL Nat Neurosci 6 (1), 28-33 (2003) PUBMED 12469125 REFERENCE 9 (bases 1 to 1322) AUTHORS Kim,S.H., Shin,J., Park,H.C., Yeo,S.Y., Hong,S.K., Han,S., Rhee,M., Kim,C.H., Chitnis,A.B. and Huh,T.L. TITLE Specification of an anterior neuroectoderm patterning by Frizzled8a-mediated Wnt8b signalling during late gastrulation in zebrafish JOURNAL Development 129 (19), 4443-4455 (2002) PUBMED 12223403 REFERENCE 10 (bases 1 to 1322) AUTHORS Chuang,J.C., Mathers,P.H. and Raymond,P.A. TITLE Expression of three Rx homeobox genes in embryonic and adult zebrafish JOURNAL Mech Dev 84 (1-2), 195-198 (1999) PUBMED 10473141 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF001909.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF001909.1, BC163788.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505371, SAMEA3505372 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1322 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..1322 /gene="rx3" /note="retinal homeobox gene 3" /db_xref="GeneID:30474" /db_xref="ZFIN:ZDB-GENE-990415-238" CDS 14..892 /gene="rx3" /note="eyes missing; chk; eym; chokh" /codon_start=1 /product="retinal homeobox protein Rx3" /protein_id="NP_571302.1" /db_xref="GeneID:30474" /db_xref="ZFIN:ZDB-GENE-990415-238" /translation="
MRLVGSQYKDMEDRLSPSARLVRSPGSQTRIHSIESILGFKGETLFHPAFPYGSGKTGKDTEHLSPKKDSNKHFDGVCRSTVMVSPDLPDADGGKLSDDENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSIKLQESSMLSIPRSGPLSLGSGLPLEPWLTGPISTSSSPLQSLPSFITPQQAVPASYTPPQFLSSSTLNHSLPHIGAVCPPYQCSGFMDKFSLQEADPRNTSIASLRMKAKEHIQSIGKTW"
misc_feature 14..94 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 107..130 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: Octapeptide motif" misc_feature 170..229 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 266..334 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 332..502 /gene="rx3" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 815..865 /gene="rx3" /note="OAR motif; Region: OAR; pfam03826" /db_xref="CDD:461067" misc_feature 827..868 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138" misc_feature 845..859 /gene="rx3" /note="propagated from UniProtKB/Swiss-Prot (O42358.1); Region: Nuclear localization signal. /evidence=ECO:0000255" ORIGIN
ggcacgaggttcaatgaggcttgttggatctcagtataaagacatggaagatcgtctctctccatccgcgcgcttggtccgcagtcccgggtcccaaacgaggatccacagcattgagtcaattctgggatttaagggagagactctgtttcacccggcgtttccatatggatcgggaaagacaggcaaagacaccgagcacttgtccccgaaaaaggactcgaataaacactttgatggagtttgtaggtctactgtaatggtcagcccggatctgccagacgcggatggtggtaaattgtcggatgatgaaaacccaaagaaaaagcacaggcggaaccgaaccacgttcaccaccttccagctccacgagctcgagcgcgccttcgagaagtcgcactatccggatgtctacagcagagaggagctcgcgctgaaggtcaacctgcccgaagtccgagtacaggtgtggttccaaaaccgtcgagctaaatggcggcgacaggagaagctggaggtgagctccatcaagctgcaggagtcctccatgctctccatccccagatcggggccactgtccctgggcagtggcctgccgttagagccctggttgaccggccccatctccacctccagctctcctctgcaatctctgcccagcttcatcacccctcagcaggccgtcccagccagctacacccctccacagttcctcagctcctccaccctcaaccacagtctgcctcatataggggctgtgtgtcccccgtatcagtgctccggctttatggataaattttcacttcaagaagcagatccacgaaacacaagcatcgcctcgctgaggatgaaagccaaggaacacattcagtctatagggaagacgtggtagatgagagacattagagacttattttagtttgtatcttcaaaatcagtggtctggatccgtttttcttttctaaacttcagttgtggacgacaatctttgtaaaaacagataaacattgtacatgactttgatttttgggtcattgtagggcaggtggatctctttcagccctctttttaacctttaaagcagttgaagagggagttaggaatggaaatgcattataaatgcaggcttttagtttcattgaatcgcatttggcattcaaaaggcccgttctgtgctaggatttattctctgttgagtactgtacaatgcagctggccactttccatgatgttttgttgtatgttttcacacttgtacagatgaattttgtattttataataaaaacaaagtcataaaaataacaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]