ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-29 11:07:45, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001126486 1309 bp mRNA linear VRT 07-JUN-2025 DEFINITION Danio rerio homeobox D12a (hoxd12a), mRNA. ACCESSION NM_001126486 XM_001340932 VERSION NM_001126486.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1309) AUTHORS Ishizaka,M., Maeno,A., Nakazawa,H., Fujii,R., Oikawa,S., Tani,T., Kanno,H., Koita,R. and Kawamura,A. TITLE The functional roles of zebrafish HoxA- and HoxD-related clusters in the pectoral fin development JOURNAL Sci Rep 14 (1), 23602 (2024) PUBMED 39384796 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1309) AUTHORS Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P. TITLE Discovery of seven hox genes in zebrafish thrombopoiesis JOURNAL Blood Cells Mol Dis 104, 102796 (2024) PUBMED 37717409 REFERENCE 3 (bases 1 to 1309) AUTHORS Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M., Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N. and Kawamura,A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 4 (bases 1 to 1309) AUTHORS Matharu,N.K., Yadav,S., Kumar,M. and Mishra,R.K. TITLE Role of vertebrate GAGA associated factor (vGAF) in early development of zebrafish JOURNAL Cells Dev 166, 203682 (2021) PUBMED 33994355 REFERENCE 5 (bases 1 to 1309) AUTHORS Smeeton,J., Natarajan,N., Naveen Kumar,A., Miyashita,T., Baddam,P., Fabian,P., Graf,D. and Crump,J.G. TITLE Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia reveals post-embryonic roles of Nkx3.2 in the skeleton JOURNAL Development 148 (2) (2021) PUBMED 33462117 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1309) AUTHORS Amores,A., Force,A., Yan,Y.L., Joly,L., Amemiya,C., Fritz,A., Ho,R.K., Langeland,J., Prince,V., Wang,Y.L., Westerfield,M., Ekker,M. and Postlethwait,J.H. TITLE Zebrafish hox clusters and vertebrate genome evolution JOURNAL Science 282 (5394), 1711-1714 (1998) PUBMED 9831563 REFERENCE 7 (bases 1 to 1309) AUTHORS Herault,Y., Beckers,J., Kondo,T., Fraudeau,N. and Duboule,D. TITLE Genetic analysis of a Hoxd-12 regulatory element reveals global versus local modes of controls in the HoxD complex JOURNAL Development 125 (9), 1669-1677 (1998) PUBMED 9521905 REFERENCE 8 (bases 1 to 1309) AUTHORS Prince,V.E., Joly,L., Ekker,M. and Ho,R.K. TITLE Zebrafish hox genes: genomic organization and modified colinear expression patterns in the trunk JOURNAL Development 125 (3), 407-420 (1998) PUBMED 9425136 REFERENCE 9 (bases 1 to 1309) AUTHORS van der Hoeven,F., Sordino,P., Fraudeau,N., Izpisua-Belmonte,J.C. and Duboule,D. TITLE Teleost HoxD and HoxA genes: comparison with tetrapods and functional evolution of the HOXD complex JOURNAL Mech Dev 54 (1), 9-21 (1996) PUBMED 8808402 REFERENCE 10 (bases 1 to 1309) AUTHORS Sordino,P., van der Hoeven,F. and Duboule,D. TITLE Hox gene expression in teleost fins and the origin of vertebrate digits JOURNAL Nature 375 (6533), 678-681 (1995) PUBMED 7791900 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JBMGRA010000009.1. On Jul 31, 2008 this sequence version replaced XM_001340932.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-619 JBMGRA010000009.1 1981522-1982140 c 620-1309 JBMGRA010000009.1 1979418-1980107 c FEATURES Location/Qualifiers source 1..1309 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="9" /map="9" gene 1..1309 /gene="hoxd12a" /gene_synonym="HOX-D12; hoxd-12; hoxd12" /note="homeobox D12a" /db_xref="GeneID:100006598" /db_xref="ZFIN:ZDB-GENE-990415-118" exon 1..619 /gene="hoxd12a" /gene_synonym="HOX-D12; hoxd-12; hoxd12" /inference="alignment:Splign:2.1.0" CDS 25..858 /gene="hoxd12a" /gene_synonym="HOX-D12; hoxd-12; hoxd12" /note="homeobox gene D-12; homeo box D12a" /codon_start=1 /product="homeobox protein Hox-D12a" /protein_id="NP_001119958.1" /db_xref="GeneID:100006598" /db_xref="ZFIN:ZDB-GENE-990415-118" /translation="
MCEHNLLSSGYVAPLLNFHSPDSLYLQNLRGNGVHLSGLPQMSYSRREVCSLPWSSSNSCTAPAQSRAYSGYSQPFFSNSAAVSASLNTHKKGSLEESGRYYFQDVSHKSEEPGRPNAAYASEQSSASNGLSNLERRQLNAVAPNELSCIEQPESDASKQSVSSIAPFQPSLSAQNIRPAFTDGTLNFSNDPSAIDTNGLPWCPSQVRSRKKRKPYTKPQLTELENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMREHTFTIY"
misc_feature 652..822
/gene="hoxd12a"
/gene_synonym="HOX-D12; hoxd-12; hoxd12"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 620..1309
/gene="hoxd12a"
/gene_synonym="HOX-D12; hoxd-12; hoxd12"
/inference="alignment:Splign:2.1.0"
ORIGIN
agcgttcctgcgagctcgtcagaaatgtgcgagcacaatctcctaagttctggctatgtcgctccccttttgaatttccactcgccagactccttgtacctccaaaacttgcgaggcaatggagtgcatctctccgggctcccgcagatgtcctacagtagaagagaggtgtgctcgctcccgtggagttcttcaaattcgtgcactgctccggcccagagccgcgcctacagtggctactctcagccgtttttcagcaattcagccgctgtgagcgctagcctcaacacccacaaaaagggctcactggaggaatccgggaggtactacttccaagatgtcagccacaaatcagaggagccaggtcgacctaatgcagcttacgcaagtgagcagagctctgccagcaatggactttcaaacctggaaaggcgacagctgaacgcagttgcacccaatgaactgagctgcattgaacagccagagagcgatgcttcaaagcagtctgtcagctccatcgctccattccagccgtcactgagcgcccagaatatcagaccagctttcaccgatggtacgctcaacttctccaatgacccttccgccatagacaccaatggactgccgtggtgtccctcacaggtgaggtcaagaaaaaagagaaaaccttacacgaagccccagctaaccgaactggagaacgaatttatgatgaacgagtttataaaccgacagaaacggaaggagctttcggacagattggaactgagtgatcagcaagtcaaaatctggtttcagaatcgcaggatgaagaaaaagagactcatgatgcgcgagcataccttcactatatactaagattttttgttgtaattggatttattaggggatccttcatacaagtgacttttcttttacgctgataaaaatacatctatttaactggaaattaaaatttaccacaaaccaattaaaagtaatttaatattcaatcggaatattttgagtttttatttatttagtatcgctgcatgtgtatgtgtctggtggtgtgaatcgagaatctgaatgatgtatatatccgaataaagtgagctttatggttaggaaccacagcaaatttaggctcgtgtatgttggattaaaaacatacattctggccccattaaaactacactgggcagctaatatagctaactggctcattaaatattcagatgttccataacatacctttgtgttaaaaacctaatttgtatcttgcacactgaatacgttttgttttgttttttcttaaccaaaagtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]