GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-01 10:26:30, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001126486            1309 bp    mRNA    linear   VRT 07-JUN-2025
DEFINITION  Danio rerio homeobox D12a (hoxd12a), mRNA.
ACCESSION   NM_001126486 XM_001340932
VERSION     NM_001126486.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1309)
  AUTHORS   Ishizaka,M., Maeno,A., Nakazawa,H., Fujii,R., Oikawa,S., Tani,T.,
            Kanno,H., Koita,R. and Kawamura,A.
  TITLE     The functional roles of zebrafish HoxA- and HoxD-related clusters
            in the pectoral fin development
  JOURNAL   Sci Rep 14 (1), 23602 (2024)
   PUBMED   39384796
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1309)
  AUTHORS   Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P.
  TITLE     Discovery of seven hox genes in zebrafish thrombopoiesis
  JOURNAL   Blood Cells Mol Dis 104, 102796 (2024)
   PUBMED   37717409
REFERENCE   3  (bases 1 to 1309)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   4  (bases 1 to 1309)
  AUTHORS   Matharu,N.K., Yadav,S., Kumar,M. and Mishra,R.K.
  TITLE     Role of vertebrate GAGA associated factor (vGAF) in early
            development of zebrafish
  JOURNAL   Cells Dev 166, 203682 (2021)
   PUBMED   33994355
REFERENCE   5  (bases 1 to 1309)
  AUTHORS   Smeeton,J., Natarajan,N., Naveen Kumar,A., Miyashita,T., Baddam,P.,
            Fabian,P., Graf,D. and Crump,J.G.
  TITLE     Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia
            reveals post-embryonic roles of Nkx3.2 in the skeleton
  JOURNAL   Development 148 (2) (2021)
   PUBMED   33462117
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1309)
  AUTHORS   Amores,A., Force,A., Yan,Y.L., Joly,L., Amemiya,C., Fritz,A.,
            Ho,R.K., Langeland,J., Prince,V., Wang,Y.L., Westerfield,M.,
            Ekker,M. and Postlethwait,J.H.
  TITLE     Zebrafish hox clusters and vertebrate genome evolution
  JOURNAL   Science 282 (5394), 1711-1714 (1998)
   PUBMED   9831563
REFERENCE   7  (bases 1 to 1309)
  AUTHORS   Herault,Y., Beckers,J., Kondo,T., Fraudeau,N. and Duboule,D.
  TITLE     Genetic analysis of a Hoxd-12 regulatory element reveals global
            versus local modes of controls in the HoxD complex
  JOURNAL   Development 125 (9), 1669-1677 (1998)
   PUBMED   9521905
REFERENCE   8  (bases 1 to 1309)
  AUTHORS   Prince,V.E., Joly,L., Ekker,M. and Ho,R.K.
  TITLE     Zebrafish hox genes: genomic organization and modified colinear
            expression patterns in the trunk
  JOURNAL   Development 125 (3), 407-420 (1998)
   PUBMED   9425136
REFERENCE   9  (bases 1 to 1309)
  AUTHORS   van der Hoeven,F., Sordino,P., Fraudeau,N., Izpisua-Belmonte,J.C.
            and Duboule,D.
  TITLE     Teleost HoxD and HoxA genes: comparison with tetrapods and
            functional evolution of the HOXD complex
  JOURNAL   Mech Dev 54 (1), 9-21 (1996)
   PUBMED   8808402
REFERENCE   10 (bases 1 to 1309)
  AUTHORS   Sordino,P., van der Hoeven,F. and Duboule,D.
  TITLE     Hox gene expression in teleost fins and the origin of vertebrate
            digits
  JOURNAL   Nature 375 (6533), 678-681 (1995)
   PUBMED   7791900
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JBMGRA010000009.1.
            
            On Jul 31, 2008 this sequence version replaced XM_001340932.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-619               JBMGRA010000009.1  1981522-1982140     c
            620-1309            JBMGRA010000009.1  1979418-1980107     c
FEATURES             Location/Qualifiers
     source          1..1309
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="9"
                     /map="9"
     gene            1..1309
                     /gene="hoxd12a"
                     /gene_synonym="HOX-D12; hoxd-12; hoxd12"
                     /note="homeobox D12a"
                     /db_xref="GeneID:100006598"
                     /db_xref="ZFIN:ZDB-GENE-990415-118"
     exon            1..619
                     /gene="hoxd12a"
                     /gene_synonym="HOX-D12; hoxd-12; hoxd12"
                     /inference="alignment:Splign:2.1.0"
     CDS             25..858
                     /gene="hoxd12a"
                     /gene_synonym="HOX-D12; hoxd-12; hoxd12"
                     /note="homeobox gene D-12; homeo box D12a"
                     /codon_start=1
                     /product="homeobox protein Hox-D12a"
                     /protein_id="NP_001119958.1"
                     /db_xref="GeneID:100006598"
                     /db_xref="ZFIN:ZDB-GENE-990415-118"
                     /translation="
MCEHNLLSSGYVAPLLNFHSPDSLYLQNLRGNGVHLSGLPQMSYSRREVCSLPWSSSNSCTAPAQSRAYSGYSQPFFSNSAAVSASLNTHKKGSLEESGRYYFQDVSHKSEEPGRPNAAYASEQSSASNGLSNLERRQLNAVAPNELSCIEQPESDASKQSVSSIAPFQPSLSAQNIRPAFTDGTLNFSNDPSAIDTNGLPWCPSQVRSRKKRKPYTKPQLTELENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMREHTFTIY"
     misc_feature    652..822
                     /gene="hoxd12a"
                     /gene_synonym="HOX-D12; hoxd-12; hoxd12"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            620..1309
                     /gene="hoxd12a"
                     /gene_synonym="HOX-D12; hoxd-12; hoxd12"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcgttcctgcgagctcgtcagaaatgtgcgagcacaatctcctaagttctggctatgtcgctccccttttgaatttccactcgccagactccttgtacctccaaaacttgcgaggcaatggagtgcatctctccgggctcccgcagatgtcctacagtagaagagaggtgtgctcgctcccgtggagttcttcaaattcgtgcactgctccggcccagagccgcgcctacagtggctactctcagccgtttttcagcaattcagccgctgtgagcgctagcctcaacacccacaaaaagggctcactggaggaatccgggaggtactacttccaagatgtcagccacaaatcagaggagccaggtcgacctaatgcagcttacgcaagtgagcagagctctgccagcaatggactttcaaacctggaaaggcgacagctgaacgcagttgcacccaatgaactgagctgcattgaacagccagagagcgatgcttcaaagcagtctgtcagctccatcgctccattccagccgtcactgagcgcccagaatatcagaccagctttcaccgatggtacgctcaacttctccaatgacccttccgccatagacaccaatggactgccgtggtgtccctcacaggtgaggtcaagaaaaaagagaaaaccttacacgaagccccagctaaccgaactggagaacgaatttatgatgaacgagtttataaaccgacagaaacggaaggagctttcggacagattggaactgagtgatcagcaagtcaaaatctggtttcagaatcgcaggatgaagaaaaagagactcatgatgcgcgagcataccttcactatatactaagattttttgttgtaattggatttattaggggatccttcatacaagtgacttttcttttacgctgataaaaatacatctatttaactggaaattaaaatttaccacaaaccaattaaaagtaatttaatattcaatcggaatattttgagtttttatttatttagtatcgctgcatgtgtatgtgtctggtggtgtgaatcgagaatctgaatgatgtatatatccgaataaagtgagctttatggttaggaaccacagcaaatttaggctcgtgtatgttggattaaaaacatacattctggccccattaaaactacactgggcagctaatatagctaactggctcattaaatattcagatgttccataacatacctttgtgttaaaaacctaatttgtatcttgcacactgaatacgttttgttttgttttttcttaaccaaaagtgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]