GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 10:10:00, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001115091            1256 bp    mRNA    linear   VRT 07-JUN-2025
DEFINITION  Danio rerio homeobox B7a (hoxb7a), mRNA.
ACCESSION   NM_001115091 XM_683101
VERSION     NM_001115091.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1256)
  AUTHORS   Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P.
  TITLE     Discovery of seven hox genes in zebrafish thrombopoiesis
  JOURNAL   Blood Cells Mol Dis 104, 102796 (2024)
   PUBMED   37717409
REFERENCE   2  (bases 1 to 1256)
  AUTHORS   Xue,S., Ly,T.T.N., Vijayakar,R.S., Chen,J., Ng,J., Mathuru,A.S.,
            Magdinier,F. and Reversade,B.
  TITLE     HOX epimutations driven by maternal SMCHD1/LRIF1 haploinsufficiency
            trigger homeotic transformations in genetically wildtype offspring
  JOURNAL   Nat Commun 13 (1), 3583 (2022)
   PUBMED   35739109
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1256)
  AUTHORS   Weiss,J.M., Hunter,M.V., Cruz,N.M., Baggiolini,A., Tagore,M.,
            Ma,Y., Misale,S., Marasco,M., Simon-Vermot,T., Campbell,N.R.,
            Newell,F., Wilmott,J.S., Johansson,P.A., Thompson,J.F., Long,G.V.,
            Pearson,J.V., Mann,G.J., Scolyer,R.A., Waddell,N., Montal,E.D.,
            Huang,T.H., Jonsson,P., Donoghue,M.T.A., Harris,C.C., Taylor,B.S.,
            Xu,T., Chaligne,R., Shliaha,P.V., Hendrickson,R., Jungbluth,A.A.,
            Lezcano,C., Koche,R., Studer,L., Ariyan,C.E., Solit,D.B.,
            Wolchok,J.D., Merghoub,T., Rosen,N., Hayward,N.K. and White,R.M.
  TITLE     Anatomic position determines oncogenic specificity in melanoma
  JOURNAL   Nature 604 (7905), 354-361 (2022)
   PUBMED   35355015
REFERENCE   4  (bases 1 to 1256)
  AUTHORS   Soto,R.A., Najia,M.A.T., Hachimi,M., Frame,J.M., Yette,G.A.,
            Lummertz da Rocha,E., Stankunas,K., Daley,G.Q. and North,T.E.
  TITLE     Sequential regulation of hemogenic fate and hematopoietic stem and
            progenitor cell formation from arterial endothelium by Ezh1/2
  JOURNAL   Stem Cell Reports 16 (7), 1718-1734 (2021)
   PUBMED   34143974
REFERENCE   5  (bases 1 to 1256)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   6  (bases 1 to 1256)
  AUTHORS   Davidson,A.J. and Zon,L.I.
  TITLE     The caudal-related homeobox genes cdx1a and cdx4 act redundantly to
            regulate hox gene expression and the formation of putative
            hematopoietic stem cells during zebrafish embryogenesis
  JOURNAL   Dev Biol 292 (2), 506-518 (2006)
   PUBMED   16457800
REFERENCE   7  (bases 1 to 1256)
  AUTHORS   Kurosawa,G., Takamatsu,N., Takahashi,M., Sumitomo,M., Sanaka,E.,
            Yamada,K., Nishii,K., Matsuda,M., Asakawa,S., Ishiguro,H.,
            Miura,K., Kurosawa,Y., Shimizu,N., Kohara,Y. and Hori,H.
  TITLE     Organization and structure of hox gene loci in medaka genome and
            comparison with those of pufferfish and zebrafish genomes
  JOURNAL   Gene 370, 75-82 (2006)
   PUBMED   16472944
  REMARK    Erratum:[Gene. 2006 Jul;376(2):298-9]
REFERENCE   8  (bases 1 to 1256)
  AUTHORS   Corredor-Adamez,M., Welten,M.C., Spaink,H.P., Jeffery,J.E.,
            Schoon,R.T., de Bakker,M.A., Bagowski,C.P., Meijer,A.H.,
            Verbeek,F.J. and Richardson,M.K.
  TITLE     Genomic annotation and transcriptome analysis of the zebrafish
            (Danio rerio) hox complex with description of a novel member, hox b
            13a
  JOURNAL   Evol Dev 7 (5), 362-375 (2005)
   PUBMED   16174031
REFERENCE   9  (bases 1 to 1256)
  AUTHORS   Santini,S. and Bernardi,G.
  TITLE     Organization and base composition of tilapia Hox genes:
            implications for the evolution of Hox clusters in fish
  JOURNAL   Gene 346, 51-61 (2005)
   PUBMED   15716008
REFERENCE   10 (bases 1 to 1256)
  AUTHORS   Davidson,A.J., Ernst,P., Wang,Y., Dekens,M.P., Kingsley,P.D.,
            Palis,J., Korsmeyer,S.J., Daley,G.Q. and Zon,L.I.
  TITLE     cdx4 mutants fail to specify blood progenitors and can be rescued
            by multiple hox genes
  JOURNAL   Nature 425 (6955), 300-306 (2003)
   PUBMED   13679919
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC163361.1 and JBMGRA010000003.1.
            
            On Mar 5, 2014 this sequence version replaced NM_001115091.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC163361.1, GFIL01012803.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1129              BC163361.1         1-1129
            1130-1256           JBMGRA010000003.1  22436043-22436169
FEATURES             Location/Qualifiers
     source          1..1256
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1256
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="homeobox B7a"
                     /db_xref="GeneID:58044"
                     /db_xref="ZFIN:ZDB-GENE-000329-2"
     exon            1..484
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    43..45
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="upstream in-frame stop codon"
     CDS             61..744
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="hox-B7; homeobox gene B-7; homeo box B7a"
                     /codon_start=1
                     /product="homeobox protein Hox-B7a"
                     /protein_id="NP_001108563.1"
                     /db_xref="GeneID:58044"
                     /db_xref="ZFIN:ZDB-GENE-000329-2"
                     /translation="
MSSLYYANALFSKYQVASSAFSTGVFPEQTSCAFSCSSQRASGYGSASTGAPVSSSSSVSLPSMYTNGTSLSSHTQGMYPTAYELGAVSLNMHSSLFDHPNLPMVSAGDLCKAQSSGKEEQRGYHQNNENNLRIYPWMRSTGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKSTDRCSPAADQIGGDEEEEDDE"
     misc_feature    460..477
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8AWY9.1);
                     Region: Antp-type hexapeptide"
     misc_feature    496..666
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    661..741
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8AWY9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            485..1256
                     /gene="hoxb7a"
                     /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tcattggacctcgtaaaaccgacactaaaacttcttagcatataaatcacttctcaaattatgagttcattgtattatgcgaacgcgctgttttccaaataccaagtggcgagttcagccttctctactggcgtgtttcccgagcaaacttcttgcgccttttcgtgcagttcgcagcgggccagcggctacggctcggcttcaaccggtgcaccggtctcttcatcatcttctgtctccctgccgagcatgtacactaacggtactagtctttccagtcatactcaaggcatgtaccccactgcgtatgagctgggagctgtctctttgaacatgcacagctctctgtttgaccatccgaatctacccatggtgagcgctggcgatctctgtaaagcgcaaagcagtggcaaggaagagcagaggggctaccatcaaaacaacgaaaacaacctccgaatctacccgtggatgaggagcacaggtgctgaccggaaaagaggccgtcagacctattcccgctaccaaacattagagctggagaaagagtttcacttcaaccgttacctttcaagacggcggcgtatcgagatagcacacgccctgtgcttaaccgagcgccagatcaaaatttggtttcaaaacaggagaatgaaatggaagaaagagaacaaatcaacggaccgctgctcgcctgctgctgatcaaattggaggcgacgaggaagaagaagatgatgagtagcaacgcaagttgaagacataataagactatactaaaatattattgatttgacttgctttaattcgggatacactgaataaaaaagttgatacttacaatactgtaggcaacgtgtctttatcgtctatgtaacttatgttagagatgttaatgtgctaaactattaaatataatactacgaactattttaaaacattttaatatagatgtataaactacatttaagacgtgaatactaatactgtataatagcctaaattccttatatataggcacaatactatattattaacatatgtttcatagcatttgtgaatcttgtatgtgtgacctattattcgttcggtctattatccactgagatcaaacaaagaagggagcaagctacttttaattatttcgaattttgatataccccttttctgtatttttgtgtaaatatttgtctggttatttttttcccttggtcatatttgtgtttgttttagaataaactgttttgctgactacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]