2025-07-13 15:49:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001085494 1703 bp mRNA linear VRT 07-DEC-2024 DEFINITION Danio rerio homeobox A13a (hoxa13a), mRNA. ACCESSION NM_001085494 XM_693696 VERSION NM_001085494.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1703) AUTHORS Cumplido,N., Arratia,G., Desvignes,T., Munoz-Sanchez,S., Postlethwait,J.H. and Allende,M.L. TITLE Hox genes control homocercal caudal fin development and evolution JOURNAL Sci Adv 10 (3), eadj5991 (2024) PUBMED 38241378 REFERENCE 2 (bases 1 to 1703) AUTHORS Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P. TITLE Discovery of seven hox genes in zebrafish thrombopoiesis JOURNAL Blood Cells Mol Dis 104, 102796 (2024) PUBMED 37717409 REFERENCE 3 (bases 1 to 1703) AUTHORS Weiss,J.M., Hunter,M.V., Cruz,N.M., Baggiolini,A., Tagore,M., Ma,Y., Misale,S., Marasco,M., Simon-Vermot,T., Campbell,N.R., Newell,F., Wilmott,J.S., Johansson,P.A., Thompson,J.F., Long,G.V., Pearson,J.V., Mann,G.J., Scolyer,R.A., Waddell,N., Montal,E.D., Huang,T.H., Jonsson,P., Donoghue,M.T.A., Harris,C.C., Taylor,B.S., Xu,T., Chaligne,R., Shliaha,P.V., Hendrickson,R., Jungbluth,A.A., Lezcano,C., Koche,R., Studer,L., Ariyan,C.E., Solit,D.B., Wolchok,J.D., Merghoub,T., Rosen,N., Hayward,N.K. and White,R.M. TITLE Anatomic position determines oncogenic specificity in melanoma JOURNAL Nature 604 (7905), 354-361 (2022) PUBMED 35355015 REFERENCE 4 (bases 1 to 1703) AUTHORS Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M., Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N. and Kawamura,A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 5 (bases 1 to 1703) AUTHORS Hawkins,M.B., Henke,K. and Harris,M.P. TITLE Latent developmental potential to form limb-like skeletal structures in zebrafish JOURNAL Cell 184 (4), 899-911 (2021) PUBMED 33545089 REFERENCE 6 (bases 1 to 1703) AUTHORS Chiu,C.H., Dewar,K., Wagner,G.P., Takahashi,K., Ruddle,F., Ledje,C., Bartsch,P., Scemama,J.L., Stellwag,E., Fried,C., Prohaska,S.J., Stadler,P.F. and Amemiya,C.T. TITLE Bichir HoxA cluster sequence reveals surprising trends in ray-finned fish genomic evolution JOURNAL Genome Res 14 (1), 11-17 (2004) PUBMED 14707166 REFERENCE 7 (bases 1 to 1703) AUTHORS Amores,A., Suzuki,T., Yan,Y.L., Pomeroy,J., Singer,A., Amemiya,C. and Postlethwait,J.H. TITLE Developmental roles of pufferfish Hox clusters and genome evolution in ray-fin fish JOURNAL Genome Res 14 (1), 1-10 (2004) PUBMED 14707165 REFERENCE 8 (bases 1 to 1703) AUTHORS Santini,S., Boore,J.L. and Meyer,A. TITLE Evolutionary conservation of regulatory elements in vertebrate Hox gene clusters JOURNAL Genome Res 13 (6A), 1111-1122 (2003) PUBMED 12799348 REMARK Erratum:[Genome Res. 2003 Aug;13(8):1973] REFERENCE 9 (bases 1 to 1703) AUTHORS Chiu,C.H., Amemiya,C., Dewar,K., Kim,C.B., Ruddle,F.H. and Wagner,G.P. TITLE Molecular evolution of the HoxA cluster in the three major gnathostome lineages JOURNAL Proc Natl Acad Sci U S A 99 (8), 5492-5497 (2002) PUBMED 11943847 REFERENCE 10 (bases 1 to 1703) AUTHORS Amores,A., Force,A., Yan,Y.L., Joly,L., Amemiya,C., Fritz,A., Ho,R.K., Langeland,J., Prince,V., Wang,Y.L., Westerfield,M., Ekker,M. and Postlethwait,J.H. TITLE Zebrafish hox clusters and vertebrate genome evolution JOURNAL Science 282 (5394), 1711-1714 (1998) PUBMED 9831563 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC133882.1. On May 23, 2007 this sequence version replaced XM_693696.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC133882.1, EH504711.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505378, SAMEA3505380 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1703 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="19" /map="19" gene 1..1703 /gene="hoxa13a" /gene_synonym="hoxa13" /note="homeobox A13a" /db_xref="GeneID:570239" /db_xref="ZFIN:ZDB-GENE-990415-5" exon 1..781 /gene="hoxa13a" /gene_synonym="hoxa13" /inference="alignment:Splign:2.1.0" misc_feature 52..54 /gene="hoxa13a" /gene_synonym="hoxa13" /note="upstream in-frame stop codon" CDS 97..1029 /gene="hoxa13a" /gene_synonym="hoxa13" /note="homeobox gene A-13; homeo box A13a" /codon_start=1 /product="homeobox protein Hox-A13a" /protein_id="NP_001078963.1" /db_xref="GeneID:570239" /db_xref="ZFIN:ZDB-GENE-990415-5" /translation="
MTTSLLLRPRWIDPVMFLYDNGGGLDDTSKNMEGFTGGNFSPSPCRNLMSHPASLAPSATYPSSEVAAAAAGDSGKQCSPCSAVQGSASASISYGYFGGGGYYPCRMSHHHGSGGGVKTCAQSPASGSPYGEKYMDTSASTGEDYTSSRAKEFALYSSYASSPYQPVPSYLDVPVVQAISGPSEPRHESLLPMESYQPWAITTSGWNGQVYCTKEQQQTGNVWKSSIPESVSHGGADGSSFRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISAQTNLSERQVTIWFQNRRVKEKKVVNKLKSSS"
misc_feature 181..540 /gene="hoxa13a" /gene_synonym="hoxa13" /note="Hox protein A13 N terminal; Region: HoxA13_N; pfam12284" /db_xref="CDD:463521" misc_feature 829..999 /gene="hoxa13a" /gene_synonym="hoxa13" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 782..1663 /gene="hoxa13a" /gene_synonym="hoxa13" /inference="alignment:Splign:2.1.0" ORIGIN
tctggatgtacgagggtgcgtcagagtcaactgtctccccttttcagtgtctaagcttcacaaaaaagagccacacgtctcaatgtccgacgggctatgacaacgtcactacttctccgcccgcgctggattgacccggtcatgtttctctatgataacggtggcggtttagacgacaccagcaaaaatatggaagggttcacaggaggtaacttctcgccaagcccgtgcaggaatttgatgtctcaccctgcctctcttgcgcccagtgctacttatccgtccagcgaagtggctgctgctgcagcgggtgattctggaaagcaatgcagcccctgctcagccgttcaaggttcagccagcgcctcaatttcctatggatatttcggaggcggtggatactatccttgccgaatgtcccaccaccatgggagtggtggaggtgtaaagacatgcgcccagtcccctgcctctggttcaccttacggagaaaaatacatggacacatcagcttctacaggcgaagattataccagctcacgcgccaaggagtttgccttgtactcaagctacgcctcaagtccatatcaaccagttccgagctatctggatgttccagtagtccaggcaataagcgggccttcggagccccgacatgagtctttactgccgatggagagttaccaaccgtgggcaatcacaaccagtggatggaacggacaggtctactgcaccaaagagcagcaacaaacgggaaacgtgtggaagtcgtcaataccagagtcagtatcccatggaggggcagacggcagctccttccgccgcggaaggaagaaacgtgttccatataccaaggtgcagctgaaggagcttgaacgggagtatgccactaacaagtttatcaccaaggacaaacgcagacggatatccgctcagaccaacctatctgaacgacaggtcactatctggttccaaaaccgacgggtaaaggagaaaaaagttgtcaacaaattaaaaagtagcagttagctttgctctgtgtaaatgtaagggaactatttttttaacaatgatgcccccaaatacacacagagagagagagagagaaagagagagagctatgaaagtatagacgtttaacgaatatgtgtttccttggactactgcttttgaagtggccactttggatcgcacagggttgatggtgacgcggtgcgtcatttctgcacttcagtgcatggccatattcccaactcagggcaaaaacggccaaaggatgagttgtttgatgagatttagtcactgctcaacaaaatatctcataaagaataatacattggatgtgtaaatgttgaaaccgtaattctttacggtgtggtacgatttttctttcaccactcccatggtcgattagaatcaaaattatgctttgcttgaaattcaagttcatgagatttcgtggaatatttgatgtggagcctgcagtttatcagtcacgtgtacatatcagtgacatgtacaatctttggctatatttgtgcaaaacaggccgtgaatactataaaatggctgttcctgtaaaagagtgttttattttatttttatttttttcgttgtatagtgtttgcaaaatccctcttaataaactctaattgaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]