LOCUS       NM_001009886             999 bp    mRNA    linear   VRT 13-MAR-2024
DEFINITION  Danio rerio motor neuron and pancreas homeobox 2a (mnx2a), mRNA.
ACCESSION   NM_001009886 XM_002663318 XM_002663319
VERSION     NM_001009886.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 999)
  AUTHORS   England,S.J., Rusnock,A.K., Mujcic,A., Kowalchuk,A., de Jager,S.,
            Hilinski,W.C., Juarez-Morales,J.L., Smith,M.E., Grieb,G.,
            Banerjee,S. and Lewis,K.E.
  TITLE     Molecular analyses of zebrafish V0v spinal interneurons and
            identification of transcriptional regulators downstream of Evx1 and
            Evx2 in these cells
  JOURNAL   Neural Dev 18 (1), 8 (2023)
   PUBMED   38017520
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 999)
  AUTHORS   Gong,J., Wang,X., Zhu,C., Dong,X., Zhang,Q., Wang,X., Duan,X.,
            Qian,F., Shi,Y., Gao,Y., Zhao,Q., Chai,R. and Liu,D.
  TITLE     Insm1a Regulates Motor Neuron Development in Zebrafish
  JOURNAL   Front Mol Neurosci 10, 274 (2017)
   PUBMED   28894416
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 999)
  AUTHORS   Pilorge,M., Fassier,C., Le Corronc,H., Potey,A., Bai,J., De
            Gois,S., Delaby,E., Assouline,B., Guinchat,V., Devillard,F.,
            Delorme,R., Nygren,G., Rastam,M., Meier,J.C., Otani,S., Cheval,H.,
            James,V.M., Topf,M., Dear,T.N., Gillberg,C., Leboyer,M., Giros,B.,
            Gautron,S., Hazan,J., Harvey,R.J., Legendre,P. and Betancur,C.
  TITLE     Genetic and functional analyses demonstrate a role for abnormal
            glycinergic signaling in autism
  JOURNAL   Mol Psychiatry 21 (7), 936-945 (2016)
   PUBMED   26370147
REFERENCE   4  (bases 1 to 999)
  AUTHORS   Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S.,
            Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M.,
            Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y.,
            Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B.,
            Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 999)
  AUTHORS   Won,M., Ro,H. and Dawid,I.B.
  TITLE     Lnx2 ubiquitin ligase is essential for exocrine cell
            differentiation in the early zebrafish pancreas
  JOURNAL   Proc Natl Acad Sci U S A 112 (40), 12426-12431 (2015)
   PUBMED   26392552
REFERENCE   6  (bases 1 to 999)
  AUTHORS   Naye,F., Voz,M.L., Detry,N., Hammerschmidt,M., Peers,B. and
            Manfroid,I.
  TITLE     Essential roles of zebrafish bmp2a, fgf10, and fgf24 in the
            specification of the ventral pancreas
  JOURNAL   Mol Biol Cell 23 (5), 945-954 (2012)
   PUBMED   22219376
REFERENCE   7  (bases 1 to 999)
  AUTHORS   Manfroid,I., Delporte,F., Baudhuin,A., Motte,P., Neumann,C.J.,
            Voz,M.L., Martial,J.A. and Peers,B.
  TITLE     Reciprocal endoderm-mesoderm interactions mediated by fgf24 and
            fgf10 govern pancreas development
  JOURNAL   Development 134 (22), 4011-4021 (2007)
   PUBMED   17942484
REFERENCE   8  (bases 1 to 999)
  AUTHORS   Zecchin,E., Filippi,A., Biemar,F., Tiso,N., Pauls,S.,
            Ellertsdottir,E., Gnugge,L., Bortolussi,M., Driever,W. and
            Argenton,F.
  TITLE     Distinct delta and jagged genes control sequential segregation of
            pancreatic cell types from precursor pools in zebrafish
  JOURNAL   Dev Biol 301 (1), 192-204 (2007)
   PUBMED   17059815
REFERENCE   9  (bases 1 to 999)
  AUTHORS   Wendik,B., Maier,E. and Meyer,D.
  TITLE     Zebrafish mnx genes in endocrine and exocrine pancreas formation
  JOURNAL   Dev Biol 268 (2), 372-383 (2004)
   PUBMED   15063174
  REMARK    GeneRIF: Required during late morphogenesis of the exocrine
            pancreas.
REFERENCE   10 (bases 1 to 999)
  AUTHORS   Zecchin,E., Mavropoulos,A., Devos,N., Filippi,A., Tiso,N.,
            Meyer,D., Peers,B., Bortolussi,M. and Argenton,F.
  TITLE     Evolutionary conserved role of ptf1a in the specification of
            exocrine pancreatic fates
  JOURNAL   Dev Biol 268 (1), 174-184 (2004)
   PUBMED   15031114
  REMARK    Erratum:[Dev Biol. 2004 Jun 1;270(1):274]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CU693367.4.
            
            On or before Dec 3, 2010 this sequence version replaced
            XM_002663318.1, XM_002663319.1, NM_001009886.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC162692.1, GDQH01032454.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505375, SAMEA3505382
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-447               CU693367.4         2088-2534
            448-608             CU693367.4         3369-3529
            609-999             CU693367.4         5769-6159
FEATURES             Location/Qualifiers
     source          1..999
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="9"
                     /map="9"
     gene            1..999
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /note="motor neuron and pancreas homeobox 2a"
                     /db_xref="GeneID:406205"
                     /db_xref="ZFIN:ZDB-GENE-040415-1"
     exon            1..447
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    15..17
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /note="upstream in-frame stop codon"
     CDS             30..959
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /note="homeo box HB9 like a"
                     /codon_start=1
                     /product="motor neuron and pancreas homeobox 2a"
                     /protein_id="NP_001009886.2"
                     /db_xref="GeneID:406205"
                     /db_xref="ZFIN:ZDB-GENE-040415-1"
                     /translation="

MDKSKNFRIDALLSESSQQIVRGDSPGLCSEGVDVDMCKRTENSLPRAFQLQTGVIPKPGMLNISHPGLTSLSQGSMPGMYPSPMYSITALGAQHPSFAYSGFTQPYPDHLKAAAMAGSLPLEHWLRAGLIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQLETDGCKSGKRGNKPKDLSRCSAHDEDEDLDPEEEAEEDEEEFRRSINVGVSLPRHSDFLQHSSALSYSSHGSYSDDDLEEIGADRKIRLGL"

     misc_feature    480..650
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            448..608
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /inference="alignment:Splign:2.1.0"
     exon            609..999
                     /gene="mnx2a"
                     /gene_synonym="hlxb9la; mnr2a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cgcgctcttgattctgaaagtttgccttcatggataagtcgaagaactttcggatagacgctctgctgtcggaaagctctcagcagatcgtgcgcggcgattccccgggactgtgcagtgaaggtgttgatgtcgacatgtgcaaacggacagaaaactctcttcctcgcgcttttcagctccagacaggggtcatacccaaaccgggcatgctaaatatttctcatccaggattaacctcactttctcaagggtctatgccaggaatgtatccatcgccaatgtactccatcacggcactgggagcgcagcatcccagcttcgcgtactctggtttcacgcagccgtatccggatcacctgaaagcggctgccatggccggttcattaccgctggagcactggctgcgtgcgggactcataatgcctcgccttgcagactacagcggggcacctcagtctggactgattggaaagtgccggagaccacgcacagccttcaccagccagcaactcctggagctggaaaatcagttcaaactcaacaaatatctatcaagacccaagcgctttgaagtggccacatctctcatgctgactgagacacaggtaaagatttggttccagaaccggcgaatgaaatggaagcgcagccgtaaagctaaagagcaggctgcgcaactggaaacagacgggtgtaaatccggcaagagaggaaacaagcccaaagacctgagccgctgcagtgcacatgacgaagatgaggatctggacccagaggaggaagccgaagaagatgaagaggagttcagacgatctattaatgtaggtgtgagtctacctcgccattcagacttcctgcagcacagctcagcactgagctacagctctcatggctcttactctgacgacgacctggaagaaattggagcagaccgaaagatcaggctagggttataaggaatcaaaggctactttagtctgcgtgtccactggtgaa

//