LOCUS       NM_001009885            1486 bp    mRNA    linear   VRT 07-APR-2024
DEFINITION  Danio rerio motor neuron and pancreas homeobox 1 (mnx1), mRNA.
ACCESSION   NM_001009885
VERSION     NM_001009885.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1486)
  AUTHORS   England,S.J., Rusnock,A.K., Mujcic,A., Kowalchuk,A., de Jager,S.,
            Hilinski,W.C., Juarez-Morales,J.L., Smith,M.E., Grieb,G.,
            Banerjee,S. and Lewis,K.E.
  TITLE     Molecular analyses of zebrafish V0v spinal interneurons and
            identification of transcriptional regulators downstream of Evx1 and
            Evx2 in these cells
  JOURNAL   Neural Dev 18 (1), 8 (2023)
   PUBMED   38017520
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1486)
  AUTHORS   Cao,S., Dong,Z., Dong,X., Jia,W., Zhou,F. and Zhao,Q.
  TITLE     Zebrafish sox2 Is Required for the Swim Bladder Inflation by
            Controlling the Swim-Up Behavior
  JOURNAL   Zebrafish 20 (1), 10-18 (2023)
   PUBMED   36795618
REFERENCE   3  (bases 1 to 1486)
  AUTHORS   Xing,L., Chai,R., Wang,J., Lin,J., Li,H., Wang,Y., Lai,B., Sun,J.
            and Chen,G.
  TITLE     Expression of myelin transcription factor 1 and lamin B receptor
            mediate neural progenitor fate transition in the zebrafish spinal
            cord pMN domain
  JOURNAL   J Biol Chem 298 (10), 102452 (2022)
   PUBMED   36063998
REFERENCE   4  (bases 1 to 1486)
  AUTHORS   Habicher,J., Manuel,R., Pedroni,A., Ferebee,C., Ampatzis,K. and
            Boije,H.
  TITLE     A new transgenic reporter line reveals expression of protocadherin
            9 at a cellular level within the zebrafish central nervous system
  JOURNAL   Gene Expr Patterns 44, 119246 (2022)
   PUBMED   35427788
REFERENCE   5  (bases 1 to 1486)
  AUTHORS   Zheng,Y.Q., Suo,G.H., Liu,D., Li,H.Y., Wu,Y.J. and Ni,H.
  TITLE     Nexmifa Regulates Axon Morphogenesis in Motor Neurons in Zebrafish
  JOURNAL   Front Mol Neurosci 15, 848257 (2022)
   PUBMED   35431796
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1486)
  AUTHORS   Ryu,S., Holzschuh,J., Erhardt,S., Ettl,A.K. and Driever,W.
  TITLE     Depletion of minichromosome maintenance protein 5 in the zebrafish
            retina causes cell-cycle defect and apoptosis
  JOURNAL   Proc Natl Acad Sci U S A 102 (51), 18467-18472 (2005)
   PUBMED   16339308
REFERENCE   7  (bases 1 to 1486)
  AUTHORS   Flanagan-Steet,H., Fox,M.A., Meyer,D. and Sanes,J.R.
  TITLE     Neuromuscular synapses can form in vivo by incorporation of
            initially aneural postsynaptic specializations
  JOURNAL   Development 132 (20), 4471-4481 (2005)
   PUBMED   16162647
REFERENCE   8  (bases 1 to 1486)
  AUTHORS   Woods,I.G., Wilson,C., Friedlander,B., Chang,P., Reyes,D.K.,
            Nix,R., Kelly,P.D., Chu,F., Postlethwait,J.H. and Talbot,W.S.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   9  (bases 1 to 1486)
  AUTHORS   Nakano,T., Windrem,M., Zappavigna,V. and Goldman,S.A.
  TITLE     Identification of a conserved 125 base-pair Hb9 enhancer that
            specifies gene expression to spinal motor neurons
  JOURNAL   Dev Biol 283 (2), 474-485 (2005)
   PUBMED   15913596
REFERENCE   10 (bases 1 to 1486)
  AUTHORS   Wendik,B., Maier,E. and Meyer,D.
  TITLE     Zebrafish mnx genes in endocrine and exocrine pancreas formation
  JOURNAL   Dev Biol 268 (2), 372-383 (2004)
   PUBMED   15063174
  REMARK    GeneRIF: Essential for differentiation of the insulin-producing
            beta-cells but not morphogenesis of pancreas.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC093243.1.
            
            On Apr 20, 2005 this sequence version replaced NM_001009885.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC093243.1, AY445044.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505372, SAMEA3505373
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1486
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="7"
                     /map="7"
     gene            1..1486
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="motor neuron and pancreas homeobox 1"
                     /db_xref="GeneID:405399"
                     /db_xref="ZFIN:ZDB-GENE-040409-1"
     exon            1..631
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    109..111
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="upstream in-frame stop codon"
     CDS             133..1068
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="Hb9; homeo box HB9"
                     /codon_start=1
                     /product="motor neuron and pancreas homeobox protein 1"
                     /protein_id="NP_001009885.1"
                     /db_xref="GeneID:405399"
                     /db_xref="ZFIN:ZDB-GENE-040409-1"
                     /translation="

MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHPMYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMADFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRDSDDEEGDNYMLNSSDCSSEDERTNDISPQP"

     misc_feature    664..834
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            632..792
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
     exon            793..1469
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agcagttgacaagtggacttctggcttgcacaccttggccaagatcataactttacgaagaggagcggtgacactcctgacagccttttaaagttacgaacgaggcgttaatctgtttgtgaggtgggccagatggagaaatctaaaaactttcggatcgacgcgcttctggctgtcgatccaccaaaagtgcagacctcgccgctggcgctggtcacctccctgcccacctcatccatatcctcctcttccgacagcgtccaggcggtggagctgaccacgaactccgacgcactccagacagagtctccatcgccacccaggatatcgtcttgcggcttgattcccaaaccgggtttcctgaactctccacattcgggcatggtcggactacaccctcagagcagtaccgggattcctcctcaggctctctacggtcacccaatgtacacgtattcagcagcagcgctcggtcagcacccggcgctctcgtactcatacccgcacggttcccaccatcatcaccatcccagcgaccccctcaaactcacagccagctcctttcagctcgaccactggctgagggtctccaccgccggaatgatgctgcctaaaatggcagatttcaatggccaggcgcagtcgaacttactcggcaagtgcagaagaccaagaactgcattcacaagccagcagctccttgaacttgagcatcagtttaagctgaataaatatctatccagaccaaaacgctttgaagtggccacgtcattgatgctaacagagacgcaggtgaaaatctggtttcagaacaggcgcatgaaatggaagcgcagtaaaaaggccaaagaacaagccgctcaagatgccgagaagcaaaagggaaaaggaaaccacgacaaaatggacggactggaaaaggactaccagaaggtagattcagggaaaagtaacagaatacgggactttagggacagtgacgacgaagaaggagataactatatgctgaattcatctgattgttcctctgaggatgaacgaaccaatgacataagtccacaaccatgagaccttataaaaacgaaagactatgagtgaattatgtgatttgtatgtatcatcatcttgcagtcaatatggaaatgcagaggtgacatccacatgagctgtttgtacacatacaaacataaatactattcctgaagagcatgtggtaatcacatcaggtaaaatagatgagtaaaggcctatcaataattaacatcattaagatgtccccatatccatgaccactgcgtgtttatttctgaattgaaataggatgaaaataggcatttcatactagaatcatacgtgatctgtttatttttatacaatgtatttataactaaatcgcttttaaaatgcatgtaaattattgttcatgtttatcagttgtacgctctgtgaataaagttacatttttgtaaaaaaaaaaaaaaaaaaa

//