2025-10-23 20:37:26, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001009885 1486 bp mRNA linear VRT 19-APR-2025 DEFINITION Danio rerio motor neuron and pancreas homeobox 1 (mnx1), mRNA. ACCESSION NM_001009885 VERSION NM_001009885.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1486) AUTHORS Lu,H., Twan,W.K., Ikawa,Y., Khare,V., Mukherjee,I., Schou,K.B., Chua,K.X., Aqasha,A., Chakrabarti,S., Hamada,H. and Roy,S. TITLE Localisation and function of key axonemal microtubule inner proteins and dynein docking complex members reveal extensive diversity among vertebrate motile cilia JOURNAL Development 151 (14) (2024) PUBMED 39007638 REFERENCE 2 (bases 1 to 1486) AUTHORS England,S.J., Rusnock,A.K., Mujcic,A., Kowalchuk,A., de Jager,S., Hilinski,W.C., Juarez-Morales,J.L., Smith,M.E., Grieb,G., Banerjee,S. and Lewis,K.E. TITLE Molecular analyses of zebrafish V0v spinal interneurons and identification of transcriptional regulators downstream of Evx1 and Evx2 in these cells JOURNAL Neural Dev 18 (1), 8 (2023) PUBMED 38017520 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1486) AUTHORS Sugitani,K., Mokuya,T., Homma,S., Maeda,M., Konno,A. and Ogai,K. TITLE Specific Activation of Yamanaka Factors via HSF1 Signaling in the Early Stage of Zebrafish Optic Nerve Regeneration JOURNAL Int J Mol Sci 24 (4), 3253 (2023) PUBMED 36834675 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1486) AUTHORS Cao,S., Dong,Z., Dong,X., Jia,W., Zhou,F. and Zhao,Q. TITLE Zebrafish sox2 Is Required for the Swim Bladder Inflation by Controlling the Swim-Up Behavior JOURNAL Zebrafish 20 (1), 10-18 (2023) PUBMED 36795618 REFERENCE 5 (bases 1 to 1486) AUTHORS Barker,C.M., Miles,K.D. and Doll,C.A. TITLE Fmrp regulates neuronal balance in embryonic motor circuit formation JOURNAL Front Neurosci 16, 962901 (2022) PUBMED 36408418 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1486) AUTHORS Ryu,S., Holzschuh,J., Erhardt,S., Ettl,A.K. and Driever,W. TITLE Depletion of minichromosome maintenance protein 5 in the zebrafish retina causes cell-cycle defect and apoptosis JOURNAL Proc Natl Acad Sci U S A 102 (51), 18467-18472 (2005) PUBMED 16339308 REFERENCE 7 (bases 1 to 1486) AUTHORS Flanagan-Steet,H., Fox,M.A., Meyer,D. and Sanes,J.R. TITLE Neuromuscular synapses can form in vivo by incorporation of initially aneural postsynaptic specializations JOURNAL Development 132 (20), 4471-4481 (2005) PUBMED 16162647 REFERENCE 8 (bases 1 to 1486) AUTHORS Woods,I.G., Wilson,C., Friedlander,B., Chang,P., Reyes,D.K., Nix,R., Kelly,P.D., Chu,F., Postlethwait,J.H. and Talbot,W.S. TITLE The zebrafish gene map defines ancestral vertebrate chromosomes JOURNAL Genome Res 15 (9), 1307-1314 (2005) PUBMED 16109975 REFERENCE 9 (bases 1 to 1486) AUTHORS Nakano,T., Windrem,M., Zappavigna,V. and Goldman,S.A. TITLE Identification of a conserved 125 base-pair Hb9 enhancer that specifies gene expression to spinal motor neurons JOURNAL Dev Biol 283 (2), 474-485 (2005) PUBMED 15913596 REFERENCE 10 (bases 1 to 1486) AUTHORS Wendik,B., Maier,E. and Meyer,D. TITLE Zebrafish mnx genes in endocrine and exocrine pancreas formation JOURNAL Dev Biol 268 (2), 372-383 (2004) PUBMED 15063174 REMARK GeneRIF: Essential for differentiation of the insulin-producing beta-cells but not morphogenesis of pancreas. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC093243.1. On Apr 20, 2005 this sequence version replaced NM_001009885.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC093243.1, AY445044.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505372, SAMEA3505373 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1486 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="7" /map="7" gene 1..1486 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /note="motor neuron and pancreas homeobox 1" /db_xref="GeneID:405399" /db_xref="ZFIN:ZDB-GENE-040409-1" exon 1..631 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /inference="alignment:Splign:2.1.0" misc_feature 109..111 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /note="upstream in-frame stop codon" CDS 133..1068 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /note="Hb9; homeo box HB9" /codon_start=1 /product="motor neuron and pancreas homeobox protein 1" /protein_id="NP_001009885.1" /db_xref="GeneID:405399" /db_xref="ZFIN:ZDB-GENE-040409-1" /translation="
MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHPMYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMADFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRDSDDEEGDNYMLNSSDCSSEDERTNDISPQP"
misc_feature 664..834 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 632..792 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /inference="alignment:Splign:2.1.0" exon 793..1469 /gene="mnx1" /gene_synonym="hlxb9; zgc:112174" /inference="alignment:Splign:2.1.0" ORIGIN
agcagttgacaagtggacttctggcttgcacaccttggccaagatcataactttacgaagaggagcggtgacactcctgacagccttttaaagttacgaacgaggcgttaatctgtttgtgaggtgggccagatggagaaatctaaaaactttcggatcgacgcgcttctggctgtcgatccaccaaaagtgcagacctcgccgctggcgctggtcacctccctgcccacctcatccatatcctcctcttccgacagcgtccaggcggtggagctgaccacgaactccgacgcactccagacagagtctccatcgccacccaggatatcgtcttgcggcttgattcccaaaccgggtttcctgaactctccacattcgggcatggtcggactacaccctcagagcagtaccgggattcctcctcaggctctctacggtcacccaatgtacacgtattcagcagcagcgctcggtcagcacccggcgctctcgtactcatacccgcacggttcccaccatcatcaccatcccagcgaccccctcaaactcacagccagctcctttcagctcgaccactggctgagggtctccaccgccggaatgatgctgcctaaaatggcagatttcaatggccaggcgcagtcgaacttactcggcaagtgcagaagaccaagaactgcattcacaagccagcagctccttgaacttgagcatcagtttaagctgaataaatatctatccagaccaaaacgctttgaagtggccacgtcattgatgctaacagagacgcaggtgaaaatctggtttcagaacaggcgcatgaaatggaagcgcagtaaaaaggccaaagaacaagccgctcaagatgccgagaagcaaaagggaaaaggaaaccacgacaaaatggacggactggaaaaggactaccagaaggtagattcagggaaaagtaacagaatacgggactttagggacagtgacgacgaagaaggagataactatatgctgaattcatctgattgttcctctgaggatgaacgaaccaatgacataagtccacaaccatgagaccttataaaaacgaaagactatgagtgaattatgtgatttgtatgtatcatcatcttgcagtcaatatggaaatgcagaggtgacatccacatgagctgtttgtacacatacaaacataaatactattcctgaagagcatgtggtaatcacatcaggtaaaatagatgagtaaaggcctatcaataattaacatcattaagatgtccccatatccatgaccactgcgtgtttatttctgaattgaaataggatgaaaataggcatttcatactagaatcatacgtgatctgtttatttttatacaatgtatttataactaaatcgcttttaaaatgcatgtaaattattgttcatgtttatcagttgtacgctctgtgaataaagttacatttttgtaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]