GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-01 07:38:24, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001009885            1486 bp    mRNA    linear   VRT 26-JAN-2025
DEFINITION  Danio rerio motor neuron and pancreas homeobox 1 (mnx1), mRNA.
ACCESSION   NM_001009885
VERSION     NM_001009885.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1486)
  AUTHORS   Lu,H., Twan,W.K., Ikawa,Y., Khare,V., Mukherjee,I., Schou,K.B.,
            Chua,K.X., Aqasha,A., Chakrabarti,S., Hamada,H. and Roy,S.
  TITLE     Localisation and function of key axonemal microtubule inner
            proteins and dynein docking complex members reveal extensive
            diversity among vertebrate motile cilia
  JOURNAL   Development 151 (14) (2024)
   PUBMED   39007638
REFERENCE   2  (bases 1 to 1486)
  AUTHORS   England,S.J., Rusnock,A.K., Mujcic,A., Kowalchuk,A., de Jager,S.,
            Hilinski,W.C., Juarez-Morales,J.L., Smith,M.E., Grieb,G.,
            Banerjee,S. and Lewis,K.E.
  TITLE     Molecular analyses of zebrafish V0v spinal interneurons and
            identification of transcriptional regulators downstream of Evx1 and
            Evx2 in these cells
  JOURNAL   Neural Dev 18 (1), 8 (2023)
   PUBMED   38017520
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1486)
  AUTHORS   Cao,S., Dong,Z., Dong,X., Jia,W., Zhou,F. and Zhao,Q.
  TITLE     Zebrafish sox2 Is Required for the Swim Bladder Inflation by
            Controlling the Swim-Up Behavior
  JOURNAL   Zebrafish 20 (1), 10-18 (2023)
   PUBMED   36795618
REFERENCE   4  (bases 1 to 1486)
  AUTHORS   Barker,C.M., Miles,K.D. and Doll,C.A.
  TITLE     Fmrp regulates neuronal balance in embryonic motor circuit
            formation
  JOURNAL   Front Neurosci 16, 962901 (2022)
   PUBMED   36408418
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1486)
  AUTHORS   Xing,L., Chai,R., Wang,J., Lin,J., Li,H., Wang,Y., Lai,B., Sun,J.
            and Chen,G.
  TITLE     Expression of myelin transcription factor 1 and lamin B receptor
            mediate neural progenitor fate transition in the zebrafish spinal
            cord pMN domain
  JOURNAL   J Biol Chem 298 (10), 102452 (2022)
   PUBMED   36063998
REFERENCE   6  (bases 1 to 1486)
  AUTHORS   Ryu,S., Holzschuh,J., Erhardt,S., Ettl,A.K. and Driever,W.
  TITLE     Depletion of minichromosome maintenance protein 5 in the zebrafish
            retina causes cell-cycle defect and apoptosis
  JOURNAL   Proc Natl Acad Sci U S A 102 (51), 18467-18472 (2005)
   PUBMED   16339308
REFERENCE   7  (bases 1 to 1486)
  AUTHORS   Flanagan-Steet,H., Fox,M.A., Meyer,D. and Sanes,J.R.
  TITLE     Neuromuscular synapses can form in vivo by incorporation of
            initially aneural postsynaptic specializations
  JOURNAL   Development 132 (20), 4471-4481 (2005)
   PUBMED   16162647
REFERENCE   8  (bases 1 to 1486)
  AUTHORS   Woods,I.G., Wilson,C., Friedlander,B., Chang,P., Reyes,D.K.,
            Nix,R., Kelly,P.D., Chu,F., Postlethwait,J.H. and Talbot,W.S.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   9  (bases 1 to 1486)
  AUTHORS   Nakano,T., Windrem,M., Zappavigna,V. and Goldman,S.A.
  TITLE     Identification of a conserved 125 base-pair Hb9 enhancer that
            specifies gene expression to spinal motor neurons
  JOURNAL   Dev Biol 283 (2), 474-485 (2005)
   PUBMED   15913596
REFERENCE   10 (bases 1 to 1486)
  AUTHORS   Wendik,B., Maier,E. and Meyer,D.
  TITLE     Zebrafish mnx genes in endocrine and exocrine pancreas formation
  JOURNAL   Dev Biol 268 (2), 372-383 (2004)
   PUBMED   15063174
  REMARK    GeneRIF: Essential for differentiation of the insulin-producing
            beta-cells but not morphogenesis of pancreas.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC093243.1.
            
            On Apr 20, 2005 this sequence version replaced NM_001009885.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC093243.1, AY445044.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505372, SAMEA3505373
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1486
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="7"
                     /map="7"
     gene            1..1486
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="motor neuron and pancreas homeobox 1"
                     /db_xref="GeneID:405399"
                     /db_xref="ZFIN:ZDB-GENE-040409-1"
     exon            1..631
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    109..111
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="upstream in-frame stop codon"
     CDS             133..1068
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="Hb9; homeo box HB9"
                     /codon_start=1
                     /product="motor neuron and pancreas homeobox protein 1"
                     /protein_id="NP_001009885.1"
                     /db_xref="GeneID:405399"
                     /db_xref="ZFIN:ZDB-GENE-040409-1"
                     /translation="
MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHPMYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMADFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRDSDDEEGDNYMLNSSDCSSEDERTNDISPQP"
     misc_feature    664..834
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            632..792
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
     exon            793..1469
                     /gene="mnx1"
                     /gene_synonym="hlxb9; zgc:112174"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcagttgacaagtggacttctggcttgcacaccttggccaagatcataactttacgaagaggagcggtgacactcctgacagccttttaaagttacgaacgaggcgttaatctgtttgtgaggtgggccagatggagaaatctaaaaactttcggatcgacgcgcttctggctgtcgatccaccaaaagtgcagacctcgccgctggcgctggtcacctccctgcccacctcatccatatcctcctcttccgacagcgtccaggcggtggagctgaccacgaactccgacgcactccagacagagtctccatcgccacccaggatatcgtcttgcggcttgattcccaaaccgggtttcctgaactctccacattcgggcatggtcggactacaccctcagagcagtaccgggattcctcctcaggctctctacggtcacccaatgtacacgtattcagcagcagcgctcggtcagcacccggcgctctcgtactcatacccgcacggttcccaccatcatcaccatcccagcgaccccctcaaactcacagccagctcctttcagctcgaccactggctgagggtctccaccgccggaatgatgctgcctaaaatggcagatttcaatggccaggcgcagtcgaacttactcggcaagtgcagaagaccaagaactgcattcacaagccagcagctccttgaacttgagcatcagtttaagctgaataaatatctatccagaccaaaacgctttgaagtggccacgtcattgatgctaacagagacgcaggtgaaaatctggtttcagaacaggcgcatgaaatggaagcgcagtaaaaaggccaaagaacaagccgctcaagatgccgagaagcaaaagggaaaaggaaaccacgacaaaatggacggactggaaaaggactaccagaaggtagattcagggaaaagtaacagaatacgggactttagggacagtgacgacgaagaaggagataactatatgctgaattcatctgattgttcctctgaggatgaacgaaccaatgacataagtccacaaccatgagaccttataaaaacgaaagactatgagtgaattatgtgatttgtatgtatcatcatcttgcagtcaatatggaaatgcagaggtgacatccacatgagctgtttgtacacatacaaacataaatactattcctgaagagcatgtggtaatcacatcaggtaaaatagatgagtaaaggcctatcaataattaacatcattaagatgtccccatatccatgaccactgcgtgtttatttctgaattgaaataggatgaaaataggcatttcatactagaatcatacgtgatctgtttatttttatacaatgtatttataactaaatcgcttttaaaatgcatgtaaattattgttcatgtttatcagttgtacgctctgtgaataaagttacatttttgtaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]