GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2024-11-23 03:46:57, GGRNA : RefSeq release 226 (Sep, 2024)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Caenorhabditis elegans Claudin (clc-1), mRNA. (825 bp)
LOCUS NM_077446 825 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans Claudin (clc-1), mRNA. ACCESSION NM_077446 VERSION NM_077446.6 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On Oct 18, 2019 this sequence version replaced...
NM_077446.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Claudin family protein (clc-31), mRNA. (689 bp)
LOCUS NM_061313 689 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans Claudin family protein (clc-31), mRNA. ACCESSION NM_061313 VERSION NM_061313.4 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003280). On May 27, 2020 this sequence...
NM_061313.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-32), mRNA. (578 bp)
Confirmed by transcript evidence; Product from WormBase gene class clc" /codon_start=1 /product="CLaudin-like in Caenorhabditis" /protein_id="NP_507064.1" /db_xref="GeneID:184272" /db_xref="WormBase:WBGene00008631" /translation="MSAVKRLFLNIVVCIGIVCNFFGVFSQAWITDYGGSIGIVPFYSTEVGWYALASWMMYISVACHLLVTILLTLVFRDVRRNGYCHYQRSQFFLIAFFSLMVTILTVTAVILIGVNLPNLNYNYNDNATLGYSAWVSVAAAVCYFIAAGLALSFAFLECRCC" misc_feature 20..490 /gene="clc-32" /locus_tag="CELE_F10A3.1" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 578) AUTHORS...
NM_074663.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-21), mRNA. (583 bp)
Confirmed by transcript evidence; Product from WormBase gene class clc" /codon_start=1 /product="CLaudin-like in Caenorhabditis" /protein_id="NP_507407.2" /db_xref="GeneID:188987" /db_xref="WormBase:WBGene00012081" /translation="MATAKRLFFTVVTIDAMTCNFFGVLSIAWVTDWSGSIGLFPLWVVTIGWYVAASLVMEVSLLCTVLVLIQLIVTSNTIRRNGYSPTQRGKFISIAVLSLFITVLTVVGVTLIGVNLPHMNRKYNDNATLGYSAWISVAGAVFYLVVAGLSISYACVECSSTKSHEPSSII" misc_feature 31..501 /gene="clc-21" /locus_tag="CELE_T27C5.8" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 583)...
NM_075006.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-4), mRNA. (669 bp)
WormBase gene class clc; Confirmed by transcript evidence" /codon_start=1 /product="CLaudin-like in Caenorhabditis" /protein_id="NP_509800.1" /db_xref="GeneID:188095" /db_xref="WormBase:WBGene525" /translation="MCSSLTQLVFGVVMLGAIALTLGATFSDKWRTVEKDLLDLYEDVQRNHTERLTGILPFLCEDGAVGCAGFWKEMKPYEKIVAICMIAALILEIVAFVWNFLTSCTCCFKKYLLHPLSPLSFLITIFLTVAIGVFYYNSDEIKDDVNIQKIWDAEAKDLNINIGSAFWMAVGAWCLVVIDTILASFAIFFAQHGV" misc_feature 16..591 /gene="clc-4" /locus_tag="CELE_T05A10.2" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1...
NM_077399.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-3), mRNA. (821 bp)
gene class clc; Confirmed by transcript evidence" /codon_start=1 /product="CLaudin-like in Caenorhabditis" /protein_id="NP_001024993.1" /db_xref="GeneID:180625" /db_xref="WormBase:WBGene524" /translation="MAMQFTGLQVVSWILLLVGTGMLVIALISDYWSIHQPRNQMDNLQMHRGVLRQCITTRQYGSCNFRLSSMFKQLRNFMDGYDMYSERSMYRHLPTQTYEVFVALFLAISCMIASTVLLFGPFCCQRCKPSTTLLIFITGVFSGSGCLIYWNANREGKTFTLQQLQFQDVYHYDYGSDMNILSWSFWMAVVSTGILLCSAFLLCVSSRVDPDVEYENPPVTEV" misc_feature 121..678 /gene="clc-3" /locus_tag="CELE_ZK563.4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
NM_001029822.7 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-3), mRNA. (874 bp)
LOCUS NM_001029823 874 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-3), mRNA. ACCESSION NM_001029823 VERSION NM_001029823.6 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On Apr...
NM_001029823.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Claudin domain-containing protein 1 (F23G4.1), partial mRNA. (555 bp)
LOCUS NM_001038454 555 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans Claudin domain-containing protein 1 (F23G4.1), partial mRNA. ACCESSION NM_001038454 VERSION NM_001038454.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284)....
NM_001038454.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-9), partial mRNA. (881 bp)
LOCUS NM_069677 881 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-9), partial mRNA. ACCESSION NM_069677 VERSION NM_069677.4 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003282). On Sep 4, 2019...
NM_069677.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Claudin domain-containing protein 2 (C25B8.8), mRNA. (1206 bp)
LOCUS NM_001029259 1206 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans Claudin domain-containing protein 2 (C25B8.8), mRNA. ACCESSION NM_001029259 VERSION NM_001029259.7 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On May...
NM_001029259.7 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-9), mRNA. (1096 bp)
LOCUS NM_001136395 1096 bp mRNA linear INV 21-AUG-2024 DEFINITION Caenorhabditis elegans CLaudin-like in Caenorhabditis (clc-9), mRNA. ACCESSION NM_001136395 VERSION NM_001136395.2 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003282). On Sep...
NM_001136395.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CASP-like protein (clc-33), mRNA. (620 bp)
db_xref="GeneID:185029" /db_xref="WormBase:WBGene00017871" /translation="MFASIAFFVVLKIIFGLAQSLTTKSGFSFLTRILFFVIAGFSALTCLFMVTAVTLVGLDVKKFNDDNAKFNNISILKLGWSAWMCVASAVLMAGSAALAVLIGLFGRPEQEFNAKTSKTSKTT" misc_feature <219..527 /gene="clc-33" /locus_tag="CELE_F28A10.3" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 620) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_061428.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Serpentine Receptor, class M (clc-28), partial mRNA. (342 bp)
db_xref="GeneID:13190439" /db_xref="WormBase:WBGene00206468" /translation="MFISIGFLIIIFPVYGIVSVKIYKSGFPISLQKWINIIAAISLLIFCFIFISVILIGSDLQMMNQLLTPTSFRLGYSAWLSVSSAVLLIPVMIPSFYFSYKKIRHFQKFNNDL" misc_feature <1..297 /gene="clc-28" /locus_tag="CELE_ZC262.11" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 342) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001379829.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane protein (clc-11), mRNA. (585 bp)
WormBase:WBGene00009710" /translation="MTAVKRLFFSALNLLGGICILIGVGTPAWLTDDGGSVGIVPFYSTEVGWFAAASWMMFISLSLAVVVSLFTAMLFRDVRRHGYSYTQRSRFFLLAMFALMVTILTVVAVILIGVNLPSFNDYWYDDATLGYSAWVSVAGAVCFFVESGLALSFAFVECNCY" misc_feature 26..496 /gene="clc-11" /locus_tag="CELE_F44G3.10" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 585) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_074662.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Serpentine receptor class gamma (K10G6.5), mRNA. (644 bp)
db_xref="GeneID:3565830" /db_xref="WormBase:WBGene00044381" /translation="MMLLSFCATVAISMFYIFSLFATLRRSSRASKFGFLIIAGLTSLAGLLQIISFIVIAIETTSWYPVIMGACEFLALLSGLIDCLMVLPLSIILSRTDFKAAKTADQWEAELDE" misc_feature <239..532 /gene="K10G6.5" /locus_tag="CELE_K10G6.5" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 644) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001027077.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane protein 225 (clc-19), mRNA. (603 bp)
xref="WormBase:WBGene00020760" /translation="MRKVGAIGVLILLGFIFNAVSVFTDSWLVWSYAKIQVTRGIVPYSSSEPTWLAAASWMMFISFGLFFPVILIYLHASHKVYHHGCCHSIRHNFNGISLLCSLIVILQAVAFILMAANASDYYGSLGYSAYFALVSGILTTIAMSLSGHVSRHDCH" misc_feature 94..555 /gene="clc-19" /locus_tag="CELE_T24C4.4" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 603) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_064881.8 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane 9 superfamily member (clc-17), mRNA. (723 bp)
translation="MLIPYACVISLMFLSVIFSAISLFTYGWATIYPFDYDYFYPDEEILVGLVPFDSFAPGWLVATSIFMYLNFACVLLTFFICIIGLIIFMLRGDSKYQKYMFVLICGSSLLTAIFGAVAFVIFVASNDGELEMDLQGKVSIGYSPFLDLIGFVIAIIGTGVSAFFTIALLNPNNEI" misc_feature 79..573 /gene="clc-17" /locus_tag="CELE_R08B4.4" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 723) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_171775.8 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Colicin V production protein (clc-29), partial mRNA. (549 bp)
translation="MNSIGLLISIIFILNTVGVLTPQWIVFSKEMTFGVLNGSSSIGIVPYRTDFVSQFPWYGVASVLMFISIGFLIIIFPVYGIVSVKIYKSGFPISLQKWINIIAAISLLIFCFIFISVILIGSDLQMMNQLLTPTSFRLGYSAWLSVSSAVLLIPVMIPSFYFSYKKIRHFQKFNNDL" misc_feature 49..504 /gene="clc-29" /locus_tag="CELE_ZC262.12" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 549) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001306706.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans MARVEL domain-containing protein (clc-14), mRNA. (704 bp)
translation="MFVDDLKTTRKICLAILLGVIQLIIIASFGAGWTSGNHWYKLFYGLPGMTAPYSTIIPYPSGAAWWYGLTAIVMYLLLFICAFYVLFTVAQVVFPDRIPFDLKMIVFIDVIFASIVTIMLLIAYAFFAGGYNGVTNIKLVGVGFGYCFWMAVASSIFSCSVVIISGLSWYRNN" misc_feature 37..507 /gene="clc-14" /locus_tag="CELE_F59C6.11" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 704) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_060355.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Sulf_transp domain-containing protein (clc-10), mRNA. (601 bp)
WBGene00018253" /translation="MLMYWKLIALAVLLGIGIIIHMVGIFSPWWTYRKKLVRVAGDDDEYDHWGVTTFGALPVSGQFAAILLDVSLIAYLAVLGVLGFIWWQVSNNGYTQFIRKMFFGFLGCSGTIIGTTILATISFAIAKDSNMSMGSSMWFCLVGGVFFNGAACGLAAYVTFCETFT" misc_feature 57..530 /gene="clc-10" /locus_tag="CELE_F40H6.1" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 601) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_065918.8 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Cytochrome C biogenesis protein (ZC262.10), partial mRNA. (528 bp)
translation="MLALKIVLGALLALSFVLNAVGVFTNEWVTSKYPLTVDAEFQNMKSLGIIPYRTEVTTMFPWFGVAEILMILTFVLFLLTIPLYGLLSFKARKDDLQPAIRAGFGALSAMSLTIFLFTIISVILIAVNLVGLNSILFKLSPESLSLGYSAWLCVVSSILMIGVFGASAFMSYSFY" misc_feature 1..501 /gene="ZC262.10" /locus_tag="CELE_ZC262.10" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 528) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001306708.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane protein (clc-26), mRNA. (1139 bp)
MADLKFLILGIFISIGFVLNIVGVVAPCFMVEKATADSKQHKCHAVNPFSSMGSSYDFASFALYTTVVCQFMVALMYGFIVYETKIKKRQYSKEILSLFYYFKWFFLLIVVLIALSFVLIAIKFQSRFNDNTVYLSYQSLLLITTIIVCSINIALSRRLVVQVARTIRQNSTHTANPFNFDTTSVYSISKN" misc_feature 102..560 /gene="clc-26" /locus_tag="CELE_Y34F4.5" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 1139) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001267910.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans MARVEL domain-containing protein (clc-13), partial mRNA. (507 bp)
WBGene00009907" /translation="MATAKRLFFTVVTIAAMACNFFGVLSNAWVTDWSGSIGLFPLWVVTIGWYVAASLVMEVSLFCTVLVLIQLIVTSNNIRRNGYSPTQRGKFISIAVLSLFITILTVVGVTLIGVNLPHMNRKYNDNATLGYSAWISVAGAVFYLVVAGLSNSYARVECGSSKLHDVNI" misc_feature 7..474 /gene="clc-13" /locus_tag="CELE_F49H6.3" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 507) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_074906.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans DUF2975 domain-containing protein (clc-20), mRNA. (2344 bp)
WormBase:WBGene00044681" /translation="MRKIAAIGGIVFISFILTIVAMFTKLWISWSIGKFSYGIGIVPYHSNSAGWFTAASWMVFISFGLFIPLILVVLFTAYKVHHDGCCHSIRHCFNSICLICSIIAVLEIIAFVLMAVNASRYVKGASISLGSSAYLDLVSAILIIVATVLSGHASHHDCH" misc_feature 1780..2253 /gene="clc-20" /locus_tag="CELE_T24C4.8" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 2344) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001368614.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans MARVEL domain-containing protein (clc-15), mRNA. (596 bp)
translation="MFLDDLKTTRKISLGILLALIQSFGAGWTQGRMNLSIDYDEVTEIPGASPPYSRLIPYPAHADWWFGLTAVMIYLLLVVCTLYMIWTVIQIVMPNRIEFDLKMIVFIDAVFSAIITLMLLIAYCFFAGGFNGKQYLDGFSFGYCFWLAVISSVVSFGVLLMNGLSWFRNN" misc_feature 147..497 /gene="clc-15" /locus_tag="CELE_F59C6.14" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 596) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001047204.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Uncharacterized protein (E_BE45912.2), mRNA. (814 bp)
misc_feature 213..689 /gene="E_BE45912.2" /locus_tag="CELE_E_BE45912.2" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 814) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 814) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted...
NM_001393273.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans MARVEL domain-containing protein (clc-15), partial mRNA. (417 bp)
db_xref="WormBase:WBGene00044792" /translation="MNLSIDYDEVTEIPGASPPYSRLIPYPAHADWWFGLTAVMIYLLLVVCTLYMIWTVIQIVMPNRIEFDLKMIVFIDAVFSAIITLMLLIAYCFFAGGFNGKQYLDGFSFGYCFWLAVISSVVSFGVLLMNGLSWFRNN" misc_feature 28..378 /gene="clc-15" /locus_tag="CELE_F59C6.14" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 417) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001047205.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans DUF2975 domain-containing protein (clc-18), mRNA. (683 bp)
MYNSRLVFLACFVFLSSIMYSVGLFSQNWVVRTRYIYLDQNRNMFTSYVDYIGIFPLKEDKRYGLSLAKVAAGISFVIHLIRLIVFVPSYCKARELGLAGVRGTFSAILGVSIVIMLLSLTGSIGLMSQNITHNKNDKLMEVEYEAGYSPYLCLISGLLDLAVCIVSGMVGCCDSRSGMSEQAVSIQK" misc_feature 65..556 /gene="clc-18" /locus_tag="CELE_T05B4.14" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 683) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001269104.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane protein (clc-25), mRNA. (838 bp)
misc_feature 30..>437 /gene="clc-25" /locus_tag="CELE_Y34F4.4" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 838) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 838) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (21-AUG-2024)...
NM_064915.8 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Cytochrome C biogenesis protein (clc-30), partial mRNA. (528 bp)
translation="MLALKIVLGALLALSFVLNAVGVFTNEWVTSKYPLTVDAEFQNMKSLGIIPYRTEVTTMFPWFGVAEILMILTFVLFLLTIPLYGLLSFKARKDDLQPAIRAGFGALSAMSLTIFLFTIISVILIAVNLVGLNSILFKLSPESLSLGYSAWLCVVSSILMIGVFGASAFMSYSFY" misc_feature 1..501 /gene="clc-30" /locus_tag="CELE_ZC262.9" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 528) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001129274.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Transmembrane 9 superfamily member (clc-23), mRNA. (660 bp)
MVDLKFCFYGLSLLTGFLLHVVGVFSPCFFTYYLYSRYYDQTDLLSYGIDPGIPWGNWFKFAVFTSYLSVVCQIFVIATYVYIVYESHNHQYSQKRVTLLKLIKWTLLVSTLLIIGSIQLITLVASREKNPTLKYGYSFWLLVGAICMSPFNILIARWFDEAAALKMKQTFAKVHPLSLEVPNDFVVLKSGYFQMSDI" misc_feature 49..495 /gene="clc-23" /locus_tag="CELE_Y34F4.1" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 660) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001129253.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Integral membrane protein (C46C11.3), mRNA. (989 bp)
misc_feature 135..656 /gene="C46C11.3" /locus_tag="CELE_C46C11.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 989) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 989) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (21-AUG-2024)...
NM_076391.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans G_PROTEIN_RECEP_F1_2 domain-containing protein (clc-27), mRNA. (674 bp)
MVNLKLYFYGVFVLICFLLHVVGILSNSIFIYYSKIMGEKDLVRVGLTFWRSWWRDASTVAVFTCLLSAIFQNLVIVAYFFVIHESHTKNQEYSYSRKLIVLLKLIKWVLLANTLFIIVNSILLTLSATSFSFGFSLWLQVASLCISPVNILIARRFEELVTLTMKQKFTKIHPLLLEIPNDSVGLKSGDPKISDL" misc_feature 76..534 /gene="clc-27" /locus_tag="CELE_Y34F4.6" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 674) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_001267908.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans DNA damage-regulated autophagy modulator protein 2 (clc-12), partial mRNA. (550 bp)
WBGene00009914" /translation="MATIKRLLFTVVVICAIVCNFFAVFSIAWVTDWSGSIGLFPLWDITIGWYIAASSLMYVSFLCSVLVFIQLIITSNNVRKNGYSHLQRGKFISIAVFSLLITVSTAVAVILIAVNLPHMNKKYYDNATLGYSAWFSVAGAVFYLVVAGFSISYARVECSFTKSQEPCSII" misc_feature 7..477 /gene="clc-12" /locus_tag="CELE_F49H6.13" /note="Tight junction protein, Claudin-like; Region: Claudin_3; pfam06653" /db_xref="CDD:399563" ORIGIN // REFERENCE 1 (bases 1 to 550) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science...
NM_074903.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Conserved plasma membrane protein (F53B3.5), mRNA. (1532 bp)
misc_feature 54..686 /gene="F53B3.5" /locus_tag="CELE_F53B3.5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 1532) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 1532) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (21-AUG-2024)...
NM_076098.9 - Caenorhabditis elegans - NCBI - UCSC - WormBase

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/ce/claudin
lang : en | div : | spe : ce | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.076 | 0.076 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Caenorhabditis elegans?to=0&format=json
0.129 | 0.053 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Caenorhabditis elegans?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.133 | 0.004 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]