LOCUS       NM_001342995            1018 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana E2F-associated phosphoprotein (AT5G08320),
            mRNA.
ACCESSION   NM_001342995
VERSION     NM_001342995.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1018)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1018)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1018)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1018)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
FEATURES             Location/Qualifiers
     source          1..1018
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1018
                     /locus_tag="AT5G08320"
                     /gene_synonym="F8L15.50; F8L15_50"
                     /db_xref="Araport:AT5G08320"
                     /db_xref="GeneID:830728"
                     /db_xref="TAIR:AT5G08320"
     CDS             117..440
                     /locus_tag="AT5G08320"
                     /gene_synonym="F8L15.50; F8L15_50"
                     /codon_start=1
                     /product="E2F-associated phosphoprotein"
                     /protein_id="NP_001331548.1"
                     /db_xref="GeneID:830728"
                     /db_xref="Araport:AT5G08320"
                     /db_xref="TAIR:AT5G08320"
                     /translation="

MASPTNSQKTVSDDEEVDYSIKPEFYDSDIDDKDELWMDKKRDGRTSDALLSCPACFTTVCLECQRYFPLSTSELGVLSSYDCYIPSRLCFLNVARAPLFNPHQCVC"

     misc_feature    192..>314
                     /locus_tag="AT5G08320"
                     /gene_synonym="F8L15.50; F8L15_50"
                     /note="E2F-associated phosphoprotein; Region: Eapp_C;
                     pfam10238"
                     /db_xref="CDD:463015"
ORIGIN      

atcgtcttcgtcggtgaacctccgatttgactgcaccgtcggagctcgacgctgagctaagcttaaccaagagctgtcgtatattacactagcagtgaagatcgaatcttaaaaccatggcttctccgaccaattcacagaaaacagtttcggatgacgaggaagttgattactccatcaaaccggagttctatgattcagatattgatgataaagatgagctttggatggataagaagagagatggtcgtacttctgatgctcttcttagctgtccagcttgtttcaccactgtctgcttagagtgtcagaggtattttcctctctcaacatcagaacttggtgttttatcttcatacgattgttatatcccatccaggctttgctttctcaatgttgctagggctccattgttcaatcctcaccaatgtgtttgctaatatattgatagtaacttgctagattctggaatgttgacttgattatgagattcttgacaattgttacaggctctaggtttttgttaggaatgacaatcttggtagaatccaaaccagttatatgacttgattaacgagaaaaatttctactctcagtccaattcccaatcccaaaacccataggcacgagcagtatgtgacacagtacagagcagtctttgtggtcaattgcaaagtaggtacagacacagttttgcaacagaatacaatgcccttaaaggttggtaaaagaaggagagattccgagatgcaagaaactggttctgaagatagcgaaaaagttaacccggtcttttgctcagcttgttccacagagatcggagtagttgacagtgaagagatctaccatttctttaatgtcattccaagcgagccttaaaacaacctggttttatgagttatttgtaacgagttctaaacaggtgattaggattaaagtttcgattgtttgcgttaatctttacgttgcatgtatatcgtttgataaaaatcaagtcactagagaattttgagttata

//