2025-10-20 08:11:35, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001342538 1970 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana ubiquitin-specific protease 27 (UBP27), mRNA. ACCESSION NM_001342538 VERSION NM_001342538.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1970) AUTHORS Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G., Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N., Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M., Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R., Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M., Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M., Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W., Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L., Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J., Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I., Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U., Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M., Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C., Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J., Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S., Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A., Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D., Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S., Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O., Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S., Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F., Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T., Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A., Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D., Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P., Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W., Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M., Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E., Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M., Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G., Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A., Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N., Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M., Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S., Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K., Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C., Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D., Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A., Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N., Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M., Martienssen,R. and McCombie,W.R. TITLE Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 769-777 (1999) PUBMED 10617198 REFERENCE 2 (bases 1 to 1970) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1970) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1970) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003075). FEATURES Location/Qualifiers source 1..1970 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="4" /ecotype="Columbia" gene 1..1970 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="Encodes a ubiquitin-specific protease." /db_xref="Araport:AT4G39370" /db_xref="GeneID:830092" /db_xref="TAIR:AT4G39370" CDS 155..1009 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /inference="Similar to RNA sequence, EST:INSD:AV827504.1,INSD:ES171789.1,INSD:BP800558.1, INSD:AV798434.1,INSD:ES176696.1,INSD:BP852013.1, INSD:AV820642.1,INSD:ES129230.1,INSD:EL001889.1, INSD:BP620977.1,INSD:AA720284.1" /inference="Similar to RNA sequence, mRNA:INSD:BX826716.1" /note="ubiquitin-specific protease 27 (UBP27); FUNCTIONS IN: ubiquitin-specific protease activity, ubiquitin thiolesterase activity; INVOLVED IN: ubiquitin-dependent protein catabolic process; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site (InterPro:IPR018200), Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 (InterPro:IPR001394); BEST Arabidopsis thaliana protein match is: ubiquitin-specific protease 4 (TAIR:AT2G22310.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)." /codon_start=1 /product="ubiquitin-specific protease 27" /protein_id="NP_001320167.1" /db_xref="GeneID:830092" /db_xref="TAIR:AT4G39370" /db_xref="Araport:AT4G39370" /translation="
MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFSGREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIVCYGRCLDALWSIA"
misc_feature 377..>898 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly...; Region: Peptidase_C19; cl02553" /db_xref="CDD:470612" misc_feature 377..>700 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly...; Region: Peptidase_C19; cl02553" /db_xref="CDD:470612" ORIGIN
taatttgcttggtcttttggccgctgaccttgtctgattgatcgggatttttgtacggcgaatcaaaatccaccgaacaaaccggaaggctaggatgctcaagctttacggattgacttagagagagatcgatttgaactgtgtcattttgagcatggtttctagaagaggctccgagacaaaagcgattgtctgtgtcctcacggatagaattaggatctctaatcaatgggtttcgcatttgtctttcgctggtctacttggtgttgctggtttcgtatttgcccaacagcacggtctattccgcaacttaaacaacttaaaactcttctccggtagagaaaaagactccggagacgattcttttctcgtacctggccttcaaaatctcggaaataactgcttcctcaacgtcatcctccaggctctagcgagctgcaaagattttaggagttttcttcaatgggttctagaggatgcgagaggttcgttagcaggagaacaagaggaacagcttcctcttacttttgctttgtctgctttattacaagagctcggcacagttggaagtagacgatctgtatctaaccctcgtaaagttatggtgacattgactgactatgccaaaaatttcaatttgacaagccaacaggatgcagcagaagcccttcttcatcttatatcttctttgcaagaagagattgtagtttgttatcgccctagccaaagtagtaatctttcggatatacttttctctcgcaacttgagaatgcttgcgcctagtgaaggcctccatggtttgatggagctcaagagatggcataaacatttgcgtggaccatttgatgggattcttggtagtactttaatgtgccgaacttgttcatctcagatttctttggagtttcagttttttcatactctgcctctttctcctttactccatcacggtggttacaacattgtatgttacggaagatgtctggatgcactttggagcattgcttgaagaagtttcttaacactgagaaagttgaaaactacttctgctatagatgctggcatggtgctgcactgaaatatttatctgtgataggagcagctgaggtagttaatctctctcagcttttaatgttattgtacttttcctttgtacatgcttcgcgactctatttgacccgtgtgtcctggaaacggtttcaatcagacggaaatcgaaaagctcaggagctgtggcggagaggaccaatgtgactgtaaaacttctcttcatcttcaaagaatgccttggtcaaatagctattcccatatattgaaacagttaatcatcgcccgtttcccaaagctcctatgcattcaagtgcaacgcgcttcgtttaacatgtttgaggaattcaaactgtcgggacatatcgcatttccacttgtcttgaacctctccttgttcacaccatcttcaataggcgtaaacatagaagaaaggattgagatgtcgtcagagtaccaaaagccagaagcatcaaaaaatcacggcatgtacaggcttgtaacagtagtggagcattttggtagaaccggaagcgggcattatactgtatacagaagtgtgagagtgttctcacaagaggaagaagaagaagattgtgatgaggatttgagctggtttagtatatctgattcagaagtttgcagagtttcagagagtgatgttcttggtgctgaagctagcttgctcttctatgaaaggctttgataaaagagaaattaatttagagcttggttttcattggattgatcgagtgttctaaggtttcttttctgcacttggagaaattagaagatacgtgagtggagttgtttttgaatatattttcgcctatagccaaacactactaaaataaccttgtaaccaaacactcttttagttccaggattgtgttataagtaaatccaaacagtccttaagcttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]